Recombinant Danio rerio Nucleoporin NDC1 (tmem48)

Shipped with Ice Packs
In Stock

Description

Production and Validation

This recombinant protein is engineered for experimental consistency:

  • Expression Systems: Optimized for solubility and yield in heterologous hosts, including bacterial (E. coli) and eukaryotic (yeast/mammalian) systems .

  • Species Specificity: Reactivity confirmed for zebrafish (Danio rerio), with no cross-reactivity in human or mouse models unless specified .

  • Antibody Compatibility: Validated with rabbit polyclonal antibodies for immunoassays .

Functional Insights from Research

NDC1’s roles extend beyond structural NPC tethering, as highlighted in studies:

NPC Assembly and Membrane Dynamics

  • Direct interaction with linker nucleoporins (e.g., Nup53/59) to stabilize curvature at NPC insertion sites .

  • Essential for anchoring ALADIN (a nuclear pore protein) to the nuclear envelope, with mutations linked to Triple-A syndrome .

Cell Cycle and Disease Associations

  • Modulates Wnt/β-catenin signaling in cervical cancer, influencing proliferation and metastasis .

  • Silencing reduces NSCLC tumorigenicity by downregulating PCNA and CYCLINB1 and inducing apoptosis .

Research Applications

This recombinant protein facilitates:

  • NPC Biogenesis Studies: Used to dissect interactions with Y-complex nucleoporins (e.g., Nup120/133) in membrane targeting .

  • Cancer Mechanistic Research: Explored in lung and cervical cancer models to identify pathways like Wnt/β-catenin .

  • Evolutionary Comparisons: Zebrafish NDC1 serves as a model for vertebrate NPC conservation .

Key Research Findings

Recent studies utilizing recombinant NDC1 include:

Study FocusKey OutcomeCitation
Membrane Curvature RegulationNDC1’s amphipathic helix coordinates with Nup53/59 to stabilize nuclear membrane topology .
Cancer Pathway ModulationNDC1 knockdown in HeLa cells suppresses β-catenin, reducing tumor growth .
Genetic InteractionsNDC1 deletion lethality rescued by NUP53 knockout, revealing functional redundancy .

Limitations and Future Directions

While recombinant Danio rerio NDC1 has enabled insights into NPC dynamics, challenges persist:

  • Species-specific functional variations may limit direct translation to human systems.

  • Structural studies require higher-purity preparations for crystallography or cryo-EM .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
ndc1; tmem48; zgc:55636; Nucleoporin NDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-671
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ndc1
Target Protein Sequence
MFSMKQNCWFIRKVVIWRAVASIAWSVLLLPITTAVFVLLSRFSLFHPIQWISDCTNLLT ASSTIFSLMVLCAVVLITGFFNLEFYTLVPSIPCSRVALLGTVLHPLQCVHSLVYSSMGM LVMWCASVIISGRYSTLGTPCMQNESGDVLTCLNEYHLFLLLAGAFMGYSHSFLGVVKNM YYVSFQPIQQYKYPQFKGCLPMLLKCSVIQSLYSTRNFAALYFFFGYVPRAWISSTLNLP IDSSLQPLDSLTGLLDFSLLYHLSISGTFLYFTWYLTVLIFRIYATEAYSFPVQSTFSED AERCLPKVVGEKSTLVMKFLALQDLALLSQHSPSRRQEVFSLSQPGGHPHNWNAISGECL CLLRDLTQRLVAHQDAVASNGRVKSQSASSDTRSASSSSSVLSGMEDVPETPRPTVPLRT PGSVFKSSVGGMHSSLTAPFTPDVDSPFCSPAIRRLVGQQDPQSPWFGTVQSPHIMRRGP KLWSASTESQSNGSPPASPAIAPSPPAANKKPSFLAQWLQNRKEQVKSFLAKRVLIVYLF NKLPEASSQALFADSQAHIWALQGLSHLVAASFSEDQFGVVQTTLPSILSSLVVLLEAVD RHFKLPHASSKPARTVCSMGDSTYKTLRFALRAALKTAIYKITTTFGEHLNAVNISTEHR KRLQQFLEFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (tmem48) is a component of the nuclear pore complex (NPC) that plays a crucial role in the de novo assembly and insertion of the NPC into the nuclear envelope. It is essential for NPC and nuclear envelope assembly, possibly by establishing a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC within the membrane.
Database Links
Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Danio rerio Nucleoporin NDC1 and what is its primary function?

Nucleoporin NDC1 (also known as TMEM48) is a key transmembrane component of the nuclear pore complex (NPC) in Danio rerio (zebrafish). It functions primarily as a critical link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane . NDC1 plays an essential role in de novo assembly and insertion of NPCs in the nuclear envelope, and is required for proper nuclear envelope assembly . The protein belongs to the NDC1 family, which is evolutionarily conserved from yeast to metazoans, highlighting its fundamental importance in eukaryotic cell biology .

How does Danio rerio NDC1 compare to its homologs in other species?

Danio rerio NDC1 shares significant homology with NDC1 proteins from other organisms, as it belongs to the evolutionarily conserved NDC1 family . While the exact sequence similarity varies between species, the functional domains that mediate nuclear pore complex assembly and membrane anchoring are typically preserved. Research has demonstrated that NDC1's role in nuclear pore complex assembly is conserved between yeast and metazoans, including vertebrates .

The conservation of NDC1 across species makes zebrafish an excellent model organism for studying NPC assembly mechanisms that may be applicable to other vertebrates, including humans. This evolutionary conservation suggests that insights gained from studying Danio rerio NDC1 can have broader implications for understanding nuclear envelope biology across species.

What is the localization pattern of NDC1 during the cell cycle?

NDC1 displays dynamic localization patterns throughout the cell cycle. During interphase, NDC1 is primarily enriched at the nuclear envelope where it is incorporated into nuclear pore complexes . It is also present in the endoplasmic reticulum (ER) and in punctate structures throughout the cytoplasm .

Upon entry into mitosis, when the nuclear envelope breaks down in organisms undergoing open mitosis, NDC1 disperses into the ER . During mitotic exit and nuclear envelope reformation, NDC1 is recruited early to the reforming nuclear envelope with similar kinetics as other inner nuclear envelope proteins such as LEM-2 . This early recruitment occurs coincident with the appearance of ER marker proteins around segregated chromosomes, suggesting that NDC1 plays an early role in establishing nuclear transport capacity during nuclear envelope reformation .

The dynamic localization of NDC1 during cell cycle progression highlights its importance in coordinating nuclear envelope breakdown and reassembly during mitosis.

What methodologies are recommended for studying NDC1's role in nuclear pore complex assembly?

To comprehensively investigate NDC1's role in nuclear pore complex assembly, researchers should consider employing a multi-faceted approach:

  • CRISPR-Cas9 gene editing: Creating NDC1 knockouts or endogenously tagged fluorescent fusion proteins (such as NDC1-mNeonGreen) allows for studying the consequences of NDC1 loss or visualizing its dynamics in living cells .

  • Live cell imaging: Combining fluorescently tagged NDC1 with markers for other nuclear envelope components enables time-lapse microscopy to analyze the kinetics of nuclear envelope formation and nuclear transport establishment .

  • Electron tomography: This technique provides high-resolution 3D visualization of nuclear envelope structure and the distribution of nuclear pore complexes, crucial for quantifying NPC density and morphology in the presence or absence of NDC1 .

  • Fluorescence Recovery After Photobleaching (FRAP): This approach can be used to measure the mobility of NDC1 and other nucleoporins within the nuclear envelope, providing insights into their dynamic interactions .

  • Co-immunoprecipitation and in vitro binding assays: These biochemical techniques are essential for characterizing interactions between NDC1 and other nucleoporins, particularly its binding partners like Nup53 .

  • RNA interference (RNAi): Targeted knockdown of NDC1 and potential interacting partners can reveal functional relationships and dependency networks among nuclear pore components .

How does the absence of NDC1 affect nuclear pore complex density and nuclear transport?

The absence of NDC1 significantly impacts both nuclear pore complex (NPC) density and nuclear transport capacity. Electron tomography studies of embryos lacking NDC1 revealed dramatic differences in nuclear envelope structure compared to controls:

ParameterControlNDC1 DeletionFold Change
NPC density (holes/μm²)378.64.3× decrease
Nuclear envelope continuityMore discontinuousMostly continuous-
Nuclear import kineticsNormalDelayed-

In NDC1-depleted cells, the nascent nuclear envelope forms with significantly fewer pores that could accommodate NPCs (8.6 holes/μm² compared to 37 holes/μm² in controls) . This represents approximately a 4.3-fold reduction in potential NPC assembly sites. Additionally, the nuclear envelope in NDC1-depleted cells appears more continuous, suggesting that NDC1 may be necessary for creating or maintaining the small membrane holes (~40-100 nm) required for initiating NPC assembly .

The functional consequence of reduced NPC density is evident in nuclear transport assays, where the establishment of nuclear import following mitosis is delayed in the absence of NDC1 . Nuclear cargo accumulation occurs at a slower rate, limiting the efficiency of nuclear-cytoplasmic exchange. These findings demonstrate that NDC1 is critical for both the structural organization of NPCs and their functional capacity to mediate transport across the nuclear envelope.

What is the relationship between NDC1 and other nucleoporins in NPC assembly?

NDC1 functions within a complex network of interactions with other nucleoporins to facilitate NPC assembly. Key relationships include:

  • NDC1-Nup53 interaction: NDC1 directly interacts with Nup53 in vitro, forming a critical link between the nuclear envelope membrane and soluble nucleoporins . This interaction helps anchor the NPC in the membrane.

  • Functional link with Nup93 complex: Research using RNA interference suggests a functional relationship between NDC1 and components of the Nup93 complex, including Nup93, Nup53, and Nup205 . These relationships are essential for proper NPC assembly.

  • Parallel pathways with Nup53: Genetic analysis reveals that NDC1 and Nup53 function in parallel pathways during nuclear assembly. When both NDC1 and Nup53 are absent, nuclear assembly catastrophically fails, indicating redundancy in their functions . Even when Nup53's membrane association region is deleted, a region of NDC1 that does not bind to Nup53 can still support NPC assembly in in vitro systems .

  • Outer ring scaffold stability: NDC1 promotes the stable association of the outer ring scaffold (Nup107-160 complex) in the nuclear envelope. In the absence of NDC1, components like Nup160 become highly mobile within the nuclear envelope rather than being stably incorporated into NPCs .

These findings suggest that NDC1 functions as a dynamic membrane adaptor that coordinates the recruitment and assembly of multiple nucleoporin subcomplexes during NPC biogenesis, rather than serving as a static structural component.

How can recombinant Danio rerio NDC1 be optimally expressed and purified for in vitro studies?

For optimal expression and purification of recombinant Danio rerio NDC1 for in vitro studies, researchers should consider the following methodological approach:

  • Expression system selection: Due to NDC1's multiple transmembrane domains, a eukaryotic expression system such as insect cells (Sf9 or High Five) or mammalian cells (HEK293 or CHO) is recommended over bacterial systems to ensure proper folding and post-translational modifications.

  • Construct design:

    • Include a cleavable affinity tag (such as His6, FLAG, or Strep-tag II) for purification

    • Consider using a fusion partner (GFP or MBP) to monitor expression and improve solubility

    • Design truncated constructs focusing on specific domains if the full-length protein proves challenging to express

  • Detergent screening: As a transmembrane protein, NDC1 requires careful detergent selection for extraction from membranes. Test a panel of mild detergents such as DDM, LMNG, or GDN, which preserve membrane protein structure and function.

  • Purification protocol:

    • Solubilize membrane fractions with the optimized detergent

    • Perform affinity chromatography using the introduced tag

    • Include a size exclusion chromatography step to ensure homogeneity

    • Consider incorporating amphipols or nanodiscs for detergent-free stabilization

  • Quality control: Assess protein quality using techniques such as thermal shift assays, circular dichroism, and negative-stain electron microscopy to verify proper folding and stability.

For functional studies, reconstitution into proteoliposomes or lipid nanodiscs can provide a native-like membrane environment to study NDC1's interactions with other nucleoporins or its role in membrane remodeling during nuclear pore formation.

What experimental approaches can be used to study NDC1's dynamics during post-mitotic nuclear envelope reformation?

Studying NDC1's dynamics during post-mitotic nuclear envelope reformation requires sophisticated live-cell imaging approaches combined with quantitative analysis. Recommended experimental strategies include:

  • Dual-color live imaging: Using endogenously tagged NDC1 (e.g., NDC1-mNeonGreen) in combination with markers for other nuclear envelope components (e.g., LEM-2-mCherry) allows for precise temporal analysis of recruitment kinetics .

  • Correlative light and electron microscopy (CLEM): This approach combines the specificity of fluorescence microscopy with the ultrastructural resolution of electron microscopy, enabling visualization of NDC1 localization in relation to reforming nuclear envelope ultrastructure.

  • Photoactivatable or photoconvertible tags: Fusing NDC1 to tags like PA-GFP or mEos allows for pulse-chase experiments to track specific populations of NDC1 molecules during nuclear envelope reformation.

  • Fluorescence correlation spectroscopy (FCS) and single-particle tracking: These techniques can measure the diffusion coefficients and binding kinetics of NDC1 molecules at different stages of nuclear envelope reformation.

  • Optogenetic tools: Light-inducible protein interaction systems can be used to perturb NDC1 function at specific timepoints during mitotic exit to dissect its temporal requirements.

  • High-speed 4D imaging: Capturing rapid three-dimensional images over time using lattice light-sheet microscopy or spinning disk confocal microscopy provides the temporal resolution necessary to observe dynamic processes during nuclear envelope reformation.

These approaches should be combined with quantitative image analysis to measure parameters such as recruitment rates, membrane association/dissociation kinetics, and spatial distribution patterns of NDC1 during the nuclear envelope reformation process.

What are the key considerations for studying NDC1 using CRISPR-Cas9 genome editing in zebrafish?

When utilizing CRISPR-Cas9 genome editing to study NDC1 in zebrafish, researchers should address several critical considerations:

  • Guide RNA design: Select target sites with minimal off-target effects using prediction tools specific for the zebrafish genome. Choose sites that disrupt critical functional domains of NDC1. Consider designing multiple guide RNAs targeting different regions of the gene to maximize editing efficiency and create diverse alleles.

  • Verification of mutations: Employ a combination of PCR, sequencing, and Western blotting to confirm successful editing. When creating fluorescently tagged versions (like NDC1-mNeonGreen), ensure that the tag does not interfere with protein localization or function .

  • Functional validation: Assess whether genetic modifications affect nuclear envelope formation and nuclear transport. Compare pronuclear size and nuclear import kinetics between wild-type and edited embryos .

  • Mosaicism management: Since F0 founders may be mosaic, establish stable lines through careful breeding and genotyping. At least two independent lines should be characterized to rule out off-target effects.

  • Heterozygote analysis: Evaluate whether heterozygous mutants display intermediate phenotypes, which can provide insights into NDC1 dosage requirements.

  • Rescue experiments: Design rescue constructs for microinjection to confirm phenotype specificity. These should include wild-type NDC1 and strategically designed mutants affecting specific functions or interactions.

  • Developmental timing: Consider that complete loss of NDC1 may have different consequences depending on developmental stage. Early embryonic lethality may necessitate conditional approaches or careful analysis before developmental arrest.

These considerations ensure the generation of reliable genetic models for studying NDC1 function in zebrafish development and nuclear envelope biology.

How can interactions between NDC1 and other nucleoporins be comprehensively mapped?

To comprehensively map interactions between NDC1 and other nucleoporins, researchers should employ a multi-layered approach combining in vitro, cellular, and in silico methods:

  • Proximity-dependent biotin labeling (BioID or TurboID): Fusing NDC1 to a biotin ligase allows identification of proteins in close proximity in living cells. This technique is particularly valuable for detecting transient or context-dependent interactions within the nuclear pore complex .

  • Co-immunoprecipitation with crosslinking: Utilizing membrane-permeable crosslinkers before cell lysis can stabilize transient interactions. Mass spectrometry analysis of co-precipitated proteins can identify the NDC1 interactome .

  • Yeast two-hybrid membrane system: Specialized membrane yeast two-hybrid systems can be used to screen for direct interactions between the cytoplasmic or nucleoplasmic domains of NDC1 and soluble nucleoporins.

  • Domain mapping through truncation analysis: Creating a series of NDC1 truncation mutants can define specific domains required for interactions with partners like Nup53 . Complementary truncations of interaction partners can pinpoint binding interfaces.

  • Surface plasmon resonance or biolayer interferometry: These techniques provide quantitative measurements of binding affinities and kinetics for interactions between purified NDC1 (or its domains) and nucleoporin partners.

  • Cryo-electron microscopy: For structural characterization of NDC1-containing subcomplexes, which can reveal interaction interfaces at near-atomic resolution.

  • Computational prediction and molecular dynamics: In silico approaches can predict potential interaction sites based on structural features and simulate the dynamics of these interactions.

  • FRET-based interaction assays: For investigating interactions in living cells with high spatial and temporal resolution during nuclear pore complex assembly.

By integrating data from these complementary approaches, researchers can construct a detailed map of NDC1's interaction network and elucidate how these interactions contribute to nuclear pore complex assembly and function.

What controls and validations are essential when studying NDC1 knockout phenotypes?

When studying NDC1 knockout phenotypes, implementing rigorous controls and validations is crucial to ensure reliable and interpretable results:

  • Multiple independent knockout lines: Generate and characterize at least two independent NDC1 knockout lines to confirm that observed phenotypes are specifically due to NDC1 loss rather than off-target effects or genetic background .

  • Rescue experiments: Reintroduce wild-type NDC1 expression in knockout cells/organisms to demonstrate phenotype reversibility. This is the gold standard for validating specificity of knockout effects .

  • Partial rescue with domain mutants: Test the ability of NDC1 constructs with mutations in specific domains to rescue knockout phenotypes, which can provide insights into domain-specific functions.

  • Heterozygote analysis: Examine whether heterozygous mutants display intermediate phenotypes, which can provide information about NDC1 dosage requirements and haploinsufficiency.

  • Complementary approaches: Validate knockout phenotypes using alternative methods such as RNAi or pharmacological inhibition where possible .

  • Temporal analysis: Carefully document the progression of phenotypes over time, especially in developing systems, to distinguish primary effects from secondary consequences.

  • Combined knockout experiments: Create double knockouts with functionally related genes (e.g., NDC1 and Nup53) to test genetic interactions and functional redundancy .

  • Quantitative phenotypic analysis: Apply rigorous quantification to phenotypic metrics, such as:

    • NPC density using electron microscopy (e.g., 37 holes/μm² in controls vs. 8.6 holes/μm² in NDC1 knockouts)

    • Nuclear import kinetics using fluorescent reporters

    • Nuclear size and morphology measurements

  • Cell type specificity: Assess whether NDC1 knockout phenotypes vary between different cell types or developmental stages, which may reveal context-dependent functions.

How might NDC1 research contribute to understanding nuclear envelope-related diseases?

Research on NDC1 has significant potential to advance our understanding of nuclear envelope-related diseases, also known as nuclear envelopathies or laminopathies. These conditions often involve defects in nuclear structure, nuclear-cytoplasmic transport, and genome organization.

NDC1's critical role in nuclear pore complex assembly and nuclear envelope formation makes it relevant to several disease contexts:

  • Progeria and premature aging syndromes: Defects in nuclear envelope structure and nuclear pore distribution are hallmarks of Hutchinson-Gilford Progeria Syndrome and related disorders. Understanding NDC1's role in maintaining nuclear envelope integrity could provide insights into these conditions .

  • Neurodegenerative diseases: Several neurodegenerative conditions, including amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD), involve disrupted nucleocytoplasmic transport. NDC1's function in establishing efficient nuclear transport pathways makes it relevant to understanding these pathologies .

  • Cancer biology: Altered expression of nucleoporins, including TMEM48 (NDC1), has been observed in various cancers. In non-small cell lung carcinoma, higher TMEM48 expression correlates with advanced tumor stage, lymph node metastasis, larger tumor size, and shorter survival time . Knockdown of TMEM48 inhibits cancer cell proliferation and affects cell cycle progression, suggesting potential therapeutic applications .

  • Developmental disorders: Given NDC1's role in nuclear envelope assembly during cell division, its dysfunction could contribute to developmental abnormalities resulting from improper nuclear formation during embryogenesis .

Future research should focus on identifying potential mutations in NDC1 in patient populations with nuclear envelope-related disorders and characterizing how these mutations affect nuclear pore complex assembly and function.

What are the emerging technologies that could advance NDC1 research?

Several cutting-edge technologies are poised to significantly advance our understanding of NDC1 biology:

  • Cryo-electron tomography: This technique allows visualization of macromolecular complexes in their native cellular environment at near-atomic resolution. Applied to NDC1-containing nuclear pore complexes, it could reveal structural details of how NDC1 anchors the NPC in the nuclear envelope membrane.

  • Single-molecule imaging in living cells: Techniques such as lattice light-sheet microscopy combined with single-particle tracking can visualize individual NDC1 molecules during nuclear pore complex assembly, providing unprecedented insights into its dynamics and interactions.

  • Genome-wide CRISPR screens: Systematic genetic interaction mapping using CRISPR-based approaches could identify new functional partners of NDC1 and place it within comprehensive genetic networks.

  • Proximity labeling proteomics: Advanced techniques like TurboID or Split-TurboID allow temporal control of proximity labeling, enabling researchers to capture dynamic changes in NDC1's interaction partners during specific stages of nuclear envelope assembly.

  • Optogenetic control of NDC1 function: Light-inducible protein interaction or degradation systems could enable precise temporal control of NDC1 function during nuclear envelope reformation.

  • Microfluidics and organ-on-chip technologies: These approaches could allow analysis of NDC1 function in more physiologically relevant contexts, including under mechanical forces that affect nuclear envelope structure.

  • AlphaFold and other AI-based structural prediction tools: These computational methods could predict the structure of NDC1 and its complexes with other nucleoporins, generating testable hypotheses about functional domains and interaction interfaces.

  • Patient-derived iPSCs: Induced pluripotent stem cells from patients with nuclear envelope-related diseases could be used to study NDC1 function in disease-relevant cellular contexts and to test potential therapeutic approaches.

These emerging technologies promise to transform our understanding of NDC1's structure, function, and role in health and disease.

How does NDC1 function differ between interphase and post-mitotic nuclear assembly?

NDC1 exhibits distinct functions and behaviors during interphase and post-mitotic nuclear assembly, reflecting the different challenges of maintaining versus rebuilding the nuclear envelope:

Interphase Functions:

  • Maintenance of existing NPCs: During interphase, NDC1 contributes to the stability and functionality of assembled nuclear pore complexes, helping maintain their anchoring within the nuclear envelope .

  • NPC quality control: Evidence suggests that NDC1 may participate in surveillance mechanisms that ensure the structural integrity of nuclear pore complexes throughout interphase.

  • Interphase NPC assembly: In growing cells, NDC1 contributes to the assembly of new NPCs that are inserted into the intact nuclear envelope during interphase, a process that differs mechanistically from post-mitotic assembly.

Post-Mitotic Functions:

  • Early recruitment to reforming nuclear envelope: NDC1 is among the earliest components recruited to the reforming nuclear envelope after mitosis, with kinetics similar to inner nuclear membrane proteins like LEM-2 .

  • Membrane hole stabilization: During post-mitotic nuclear envelope reformation, NDC1 appears necessary for creating or maintaining the small (~40-100 nm) holes in the nuclear envelope that serve as assembly sites for nuclear pore complexes .

  • Scaffold nucleoporin recruitment: NDC1 promotes the stable association of outer ring scaffold components (Nup107-160 complex) with the reforming nuclear envelope. In the absence of NDC1, these components show increased mobility rather than stable incorporation into assembling NPCs .

  • Parallel pathway with Nup53: During post-mitotic assembly, NDC1 functions in a pathway parallel to Nup53. When both proteins are absent, nuclear assembly catastrophically fails, suggesting redundancy in their functions during this critical process .

The differential requirements for NDC1 in these contexts likely reflect the distinct molecular mechanisms involved in assembling NPCs into an intact versus a reforming nuclear envelope. Understanding these context-specific functions has important implications for both basic cell biology and disease states involving altered cell proliferation.

What are common challenges in working with recombinant NDC1 and how can they be addressed?

Working with recombinant NDC1 presents several technical challenges due to its nature as a multi-pass transmembrane protein. Here are common obstacles researchers encounter and strategies to overcome them:

  • Low expression levels:

    • Challenge: As a transmembrane protein, NDC1 often expresses poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and consider fusion tags that enhance expression (such as MBP or SUMO). Testing multiple expression hosts, including specialized membrane protein expression strains, can identify optimal systems.

  • Protein misfolding and aggregation:

    • Challenge: Transmembrane proteins like NDC1 frequently misfold when overexpressed.

    • Solution: Lower the expression temperature (e.g., 16-18°C for bacterial or insect cell systems), use milder induction conditions, and consider co-expression with chaperones. Expression in eukaryotic systems that more closely match the native environment may improve folding.

  • Inefficient membrane extraction:

    • Challenge: Extracting NDC1 from membranes while maintaining its native conformation is difficult.

    • Solution: Screen a panel of detergents to identify those that efficiently solubilize NDC1 while preserving its structure and function. Consider novel solubilization approaches such as SMALPs (styrene-maleic acid lipid particles) that extract membrane proteins with their native lipid environment.

  • Protein instability during purification:

    • Challenge: NDC1 may lose stability during multi-step purification procedures.

    • Solution: Minimize purification steps, maintain detergent throughout the process, and include stabilizing agents like glycerol or specific lipids. Consider rapid purification protocols at 4°C with protease inhibitors present throughout.

  • Difficulty in functional validation:

    • Challenge: Assessing whether purified NDC1 retains native functionality is complex.

    • Solution: Develop in vitro binding assays with known interaction partners like Nup53 . Reconstitution into liposomes followed by biophysical studies can verify membrane integration and topology.

  • Poor yield of full-length protein:

    • Challenge: Obtaining sufficient quantities of intact NDC1 for biochemical studies.

    • Solution: Consider expressing functional domains separately if the full-length protein proves refractory to high-yield expression. Alternatively, develop strategies for domain co-expression followed by reconstitution of the complex.

By systematically addressing these challenges through careful optimization of expression and purification conditions, researchers can successfully work with recombinant NDC1 for structural and functional studies.

How can researchers differentiate between direct and indirect effects of NDC1 depletion?

Distinguishing direct effects of NDC1 depletion from secondary or compensatory responses requires careful experimental design and multiple complementary approaches:

  • Acute vs. chronic depletion:

    • Implement systems for rapid protein depletion, such as auxin-inducible degron (AID) tags or dTAG approaches, to observe immediate consequences before compensatory mechanisms engage.

    • Compare these results with long-term knockout phenotypes to identify differences that may represent adaptive responses.

  • Rescue experiments with structure-function analysis:

    • Express NDC1 variants with mutations in specific domains to determine which functions are required to rescue particular phenotypes.

    • Time-resolved rescue experiments can identify which phenotypes are reversed earliest after NDC1 reintroduction, suggesting more direct dependencies.

  • Analysis of interaction partners:

    • Monitor the localization, stability, and function of known NDC1 interaction partners (such as Nup53) immediately following NDC1 depletion .

    • Identify proteins whose altered behavior precedes other phenotypic changes, suggesting more direct relationships.

  • Temporal analysis of phenotypes:

    • Establish a detailed timeline of phenotypic changes following NDC1 depletion. Earlier phenotypes are more likely to represent direct effects.

    • For example, increased mobility of Nup160 in the nuclear envelope likely represents a direct consequence of NDC1 loss, while subsequent defects in nuclear transport may be downstream effects .

  • Partial depletion analysis:

    • Create a series of partial NDC1 depletion conditions to establish dose-response relationships for various phenotypes.

    • Direct effects typically show more linear relationships with protein levels compared to indirect effects, which may exhibit threshold responses.

  • Comparative analysis across systems:

    • Compare NDC1 depletion phenotypes across different cell types, developmental stages, or model organisms.

    • Consistent early phenotypes across systems are more likely to represent direct effects of NDC1 loss.

  • In vitro reconstitution:

    • Recapitulate key aspects of NDC1 function in minimal reconstituted systems to identify essential components and interactions.

    • Functions that can be reconstituted with purified components are likely direct effects of NDC1.

By integrating data from these complementary approaches, researchers can build a hierarchical model of NDC1-dependent processes, distinguishing primary functions from their downstream consequences.

What is the potential role of NDC1 in disease pathogenesis and as a therapeutic target?

NDC1/TMEM48 is emerging as a significant factor in disease pathogenesis and may represent a novel therapeutic target, particularly in cancer and nuclear envelope-related disorders:

  • Oncogenic potential:

    • Overexpression of TMEM48 (NDC1) has been documented in non-small cell lung carcinoma (NSCLC), with higher expression correlating with advanced tumor stage, lymph node metastasis, larger tumor size, and shorter patient survival times .

    • Knockdown of TMEM48 in NSCLC cell lines inhibits cell proliferation and significantly increases the cell population in G1 phase, suggesting its involvement in cell cycle regulation .

    • Gene set enrichment analysis (GSEA) has shown that cell cycle pathways correlate with TMEM48 expression, further supporting its role in cancer progression .

  • Potential in nuclear envelope-related disorders:

    • Given NDC1's central role in nuclear pore complex assembly and nuclear envelope integrity, it may be implicated in laminopathies and other nuclear envelope-related disorders.

    • Defects in nuclear-cytoplasmic transport are increasingly recognized as contributors to neurodegenerative diseases like ALS and FTD, positioning NDC1 as a potential factor in these conditions.

  • Therapeutic approaches targeting NDC1:

    • Direct inhibition: Small molecule inhibitors disrupting NDC1's interaction with key binding partners like Nup53 could modulate nuclear pore assembly in malignant cells .

    • Expression modulation: In cancers with NDC1/TMEM48 overexpression, antisense oligonucleotides or siRNA approaches could reduce expression to normal levels .

    • Targeted protein degradation: Proteolysis-targeting chimeras (PROTACs) or molecular glues could selectively degrade NDC1 in disease contexts.

    • Interaction interface targeting: Peptide mimetics or small molecules that compete for binding at critical interaction interfaces could modulate NDC1 function without complete inhibition.

  • Biomarker potential:

    • NDC1/TMEM48 expression levels could serve as prognostic biomarkers in certain cancers, as suggested by correlations with survival in NSCLC .

    • Changes in NDC1 localization or post-translational modifications might indicate altered nuclear envelope dynamics in various pathological states.

Future research should focus on comprehensive characterization of NDC1 expression, mutation, and dysfunction across various disease states, as well as developing specific modulators of NDC1 function that could serve as both research tools and potential therapeutic leads.

How might NDC1 research contribute to understanding evolutionary adaptations in nuclear envelope architecture?

Research on NDC1 offers unique insights into the evolutionary adaptations of nuclear envelope architecture across species:

  • Conservation and divergence patterns:

    • NDC1 belongs to a family that is conserved from yeast to humans, indicating its fundamental importance in eukaryotic cell biology .

    • Comparative genomics of NDC1 across species can reveal conserved functional domains versus lineage-specific adaptations, providing insights into the evolution of nuclear pore complex architecture.

    • The presence of NDC1 homologs across diverse eukaryotic lineages makes it a valuable marker for tracking the evolution of nuclear envelope complexity.

  • Adaptation to different mitotic strategies:

    • NDC1's role differs between organisms with open mitosis (where the nuclear envelope breaks down) versus closed mitosis (where it remains intact) .

    • Studying NDC1 function across organisms with different mitotic strategies (e.g., comparing yeast, Danio rerio, and mammalian systems) can reveal how nuclear envelope components have adapted to these divergent cell division mechanisms.

  • Interfaces between membrane and soluble nucleoporins:

    • As a transmembrane nucleoporin that links membrane components to soluble nucleoporins, NDC1 represents a critical interface whose evolution likely shaped nuclear pore complex architecture .

    • The interaction between NDC1 and Nup53 exemplifies how membrane-nucleoporin interfaces have evolved to facilitate nuclear pore assembly and stability .

  • Specialized nuclear envelope functions:

    • Comparing NDC1 function across specialized cell types (e.g., neurons, muscle cells, gametes) can reveal how nuclear envelope architecture has adapted to support tissue-specific functions.

    • Model organisms like Danio rerio offer the opportunity to study NDC1 in diverse developmental contexts, providing insights into how nuclear envelope assembly mechanisms have been modified during development.

  • Paralog diversification:

    • In some lineages, NDC1 paralogs may have evolved specialized functions, reflecting adaptation of nuclear envelope architecture to specific cellular or developmental contexts.

    • Analyzing such paralogs can reveal how gene duplication and subsequent functional diversification contributed to the evolution of nuclear envelope complexity.

By integrating findings from comparative genomics, structural biology, and functional studies across diverse organisms, NDC1 research can illuminate the evolutionary history of the nuclear envelope and nuclear pore complexes, one of the defining features of eukaryotic cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.