Recombinant Danio rerio Nurim (nrm)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Background

Nurim (nuclear envelope membrane protein) is encoded by the nrm gene in zebrafish (Danio rerio), with the following genomic characteristics :

AttributeDetails
Gene ID570027
mRNA RefSeqNM_001045195
Protein RefSeqNP_001038660
UniProt IDQ1L911
Chromosomal Locationchr21:10188522-10190461 (Zv9 assembly)

Nurim is conserved across vertebrates, with zebrafish homologs sharing functional domains critical for nuclear membrane integrity .

Recombinant Protein Production

Recombinant zebrafish Nurim is typically expressed in mammalian cell systems to ensure proper post-translational modifications. Key production parameters include :

ParameterSpecification
Expression SystemMammalian cells (e.g., HEK293)
TagPolyhistidine (His-tag)
Purity>80% (SDS-PAGE verified)
Storage-20°C to -80°C in PBS buffer
Endotoxin Levels<1.0 EU/μg

The protein is available in liquid or lyophilized formats, with custom modifications (e.g., Fc-Avi tags) for specific assays .

Applications in Biomedical Research

Recombinant Nurim is utilized in:

  1. Drug discovery: High-throughput screens for nuclear transport inhibitors .

  2. Gene expression studies: Mapping nuclear membrane-protein interactions via pull-down assays .

  3. Developmental biology: Investigating nuclear dynamics during embryogenesis .

A 2020 study identified Nurim as part of a zebrafish proteomic signature predictive of chemical toxicity .

Research Limitations and Future Directions

  • Functional redundancy: Duplicated genes in zebrafish may compensate for nrm knockdowns, complicating phenotyping .

  • Structural data: No crystallography or cryo-EM structures exist for zebrafish Nurim, hindering mechanistic studies.

Current efforts focus on generating tissue-specific nrm knockouts and antibody probes for in vivo localization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
nrm; si:dkey-263h23.2; Nurim; Nuclear envelope membrane protein; Nuclear rim protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
nrm
Target Protein Sequence
MASVTFRDGFLCVSALITFVFVFVTGADFVRFVSFRAINHNLSGAAPLCRDSVPWSVALR DGVVQKAVAVDVLLLVVFSLQHSLLAWTPVKRVCQSVFGVLSRSVYCFTTAAALQILMHY WRPVTSAPCLWSVSSAPWEIWFPLICFIVHFLCWAIICSILLIFDYPELLGIKQVYYECL GLGDPLLLKSERAQRLYSHLRHPVCVELLTVLWLLPSFPLDRLLLAVFLTVYLILAHSLD KQDCAYLRHQLRNKLQLFSTPLEGSEQTNDNNKLE
Uniprot No.

Target Background

Database Links
Protein Families
Nurim family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein.

Q&A

What is Nurim (nrm) and what is its role in zebrafish?

Nurim (nuclear rim protein) is a nuclear envelope membrane protein that plays a role in nuclear organization. In zebrafish, as in other vertebrates, it is integrated into the inner nuclear membrane. Based on comparative analysis with mammalian models, zebrafish Nurim likely contributes to nuclear envelope integrity and potentially interacts with chromatin organization systems during early development. Similar to mouse Nurim, which shows broad expression in tissues like testis and spleen, zebrafish Nurim exhibits tissue-specific expression patterns throughout development .

How conserved is the nrm gene between zebrafish and mammals?

The nrm gene is part of the evolutionary conservation between zebrafish and mammals that diverged approximately 400-450 million years ago. Both species belong to the bony vertebrate lineage (Osteichthyes), and despite this evolutionary distance, many nuclear envelope proteins show functional conservation. Zebrafish and humans share extensive sequence and functional conservation throughout their genomes, making zebrafish a valuable model for studying nuclear envelope proteins. The specific conservation level of Nurim can be analyzed through sequence alignment tools to evaluate structural and functional domains that may be preserved across species .

What expression patterns does nrm show during zebrafish development?

Zebrafish Nurim expression patterns follow developmental stage-specific regulation. While the search results don't provide specific expression data for zebrafish Nurim, comparative analysis with mouse Nurim suggests that expression is likely broad across multiple tissues. In mouse, Nurim shows particularly high expression in adult testis (RPKM 84.9) and spleen (RPKM 32.1), with expression in at least 21 other tissues . In zebrafish, expression analysis can be conducted at different developmental stages (e.g., early embryogenesis, organogenesis) using techniques such as in situ hybridization, RT-PCR, or RNA-seq to establish tissue-specific and temporal expression patterns.

What are the optimal expression systems for producing recombinant Danio rerio Nurim?

For recombinant zebrafish Nurim production, researchers should consider several expression systems, each with specific advantages:

  • HEK293T cells: Commonly used for nuclear membrane proteins, as demonstrated with mouse Nurim . This mammalian system provides appropriate post-translational modifications and membrane targeting.

  • Bacterial systems (E. coli): May be suitable for producing specific domains but often challenging for full-length membrane proteins due to improper folding.

  • Insect cell systems: Baculovirus expression systems can yield higher amounts of properly folded membrane proteins compared to bacterial systems.

The optimal approach depends on the research application. For structural studies, high purity (>90%) is essential, while functional assays might require proper post-translational modifications available in mammalian systems. Based on mouse Nurim production methodologies, HEK293T cells with C-terminal tags (MYC/DDK) provide a reliable starting point for zebrafish Nurim expression .

What purification strategies are most effective for recombinant zebrafish Nurim?

Purification of recombinant zebrafish Nurim requires specialized protocols for membrane proteins:

Purification StepMethodologyCritical Parameters
Cell LysisGentle detergent solubilization (e.g., DDM, CHAPS)Detergent concentration, temperature, pH
Affinity ChromatographyTag-based purification (His, MYC, DDK)Buffer composition, detergent concentration
Size ExclusionSeparation based on molecular weightFlow rate, column selection
Purity AssessmentSDS-PAGE and Coomassie blue stainingTarget purity >80% for functional studies

The purification protocol should maintain protein stability while removing contaminants. Based on mouse Nurim protocols, appropriate storage conditions include 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol at -80°C, with measures to avoid repeated freeze-thaw cycles .

How can researchers verify the structure and function of purified recombinant zebrafish Nurim?

Verification of recombinant zebrafish Nurim structure and function should involve multiple complementary approaches:

  • Structural Verification:

    • Western blotting with anti-tag antibodies and/or Nurim-specific antibodies

    • Mass spectrometry for sequence confirmation and post-translational modification identification

    • Circular dichroism to assess secondary structure elements

  • Functional Verification:

    • Membrane integration assays to confirm proper targeting to nuclear membranes

    • Protein-protein interaction studies with known nuclear envelope partners

    • In vitro reconstitution systems to assess membrane integration properties

These verification steps ensure that the recombinant protein maintains native-like properties necessary for downstream applications. Comparison with mouse Nurim characteristics, which include a molecular mass of approximately 29.4 kDa, can provide baseline expectations for the zebrafish ortholog .

How can CRISPR/Cas9 be optimized for nrm gene editing in zebrafish?

Optimizing CRISPR/Cas9 for zebrafish nrm editing requires careful consideration of several factors:

  • Guide RNA (gRNA) Design:

    • Target conserved exons coding for functional domains

    • Analyze potential off-target effects using zebrafish genome databases

    • Design multiple gRNAs targeting different regions to increase editing efficiency

  • Delivery Method:

    • Microinjection into one-cell stage embryos (most common approach)

    • Optimize Cas9 mRNA or protein concentration (typically 150-300 ng/μL) and gRNA concentration (25-50 ng/μL)

  • Mutation Screening:

    • High-resolution melt analysis (HRMA) for rapid screening

    • T7 endonuclease I assay to detect heteroduplexes

    • Direct sequencing of PCR products spanning the target region

  • Establishment of Stable Lines:

    • Screen F0 mosaic founders for germline transmission

    • Confirm mutations in F1 generation through sequencing

    • Establish homozygous lines through appropriate crossing strategies

The zebrafish model offers advantages for nrm functional studies due to its fully sequenced and annotated genome and advanced genetic tools available for manipulation .

What phenotyping approaches are most informative for studying nrm function in zebrafish?

Comprehensive phenotyping approaches for nrm-modified zebrafish should include:

  • Developmental Analysis:

    • Time-lapse imaging during early embryogenesis

    • Assessment of developmental milestones and potential delays

    • Morphological analysis of nuclear envelope structure using fluorescent markers

  • Tissue-Specific Analysis:

    • Histological examination of tissues with high nrm expression

    • Immunohistochemistry to assess nuclear morphology and organization

    • Live imaging of tagged nuclear envelope components

  • Molecular Phenotyping:

    • Transcriptome analysis (RNA-seq) to identify differentially expressed genes

    • Chromatin organization assessment (ChIP-seq, Hi-C)

    • Proteomic analysis of nuclear envelope composition

  • Functional Assays:

    • Cell cycle progression analysis in developing embryos

    • DNA damage response assessment

    • Stress response evaluation

The zebrafish model is particularly valuable due to its optical transparency during larval stages, allowing for high-resolution visualization of cellular processes in vivo .

How does zebrafish sex-specific recombination affect nrm genetic studies?

Sex-specific recombination rates in zebrafish significantly impact experimental design for nrm genetic studies:

  • Mapping Considerations:

    • Male zebrafish show dramatically suppressed recombination rates compared to females, especially near centromeres

    • This differential recombination affects linkage analysis and positional cloning strategies

  • Strategic Application:

    • For fine mapping of nrm or associated loci, female meiosis maximizes the ratio of genetic map distance to physical distance

    • For maintaining linkage relationships or initial linkage group assignment, male meiosis minimizes recombination

  • Experimental Design Implications:

    • Select appropriate sex-specific meiotic mapping panels based on research objectives

    • Consider sex-averaged maps for general reference but utilize sex-specific approaches for specialized applications

    • Document parental sex in all crossing schemes to account for recombination differences

This sex-specific recombination phenomenon must be considered when designing genetic screens, mapping mutations, or performing association studies involving the nrm locus in zebrafish .

How can zebrafish nrm be utilized in host-pathogen interaction studies?

Zebrafish nrm can be investigated in host-pathogen interaction studies using these methodological approaches:

  • Infection Models:

    • Create nrm reporter lines to visualize dynamic changes during infection

    • Employ microinjection techniques for direct pathogen delivery

    • Utilize immersion methods for mucosal infection routes

  • Immune Response Assessment:

    • Study potential nrm involvement in inflammatory pathways through PRR activation

    • Investigate nuclear envelope remodeling during immune cell activation

    • Analyze potential interactions with NF-κB signaling pathways, which are highly conserved in zebrafish

  • Time-Course Analysis:

    • Track nuclear envelope dynamics during different infection phases

    • Monitor potential relocalization of nrm during immune activation

    • Assess correlation between nrm expression/localization and infection outcomes

Zebrafish larvae provide a unique opportunity to study these processes as they rely exclusively on innate immune responses during early development (before 4-6 weeks post-fertilization), allowing examination of these mechanisms without adaptive immunity interference .

What comparative genomics approaches reveal evolutionary insights about nrm across species?

Comparative genomics approaches for evolutionary analysis of nrm include:

  • Sequence Analysis:

    • Multiple sequence alignment of nrm orthologs across species

    • Phylogenetic tree construction to establish evolutionary relationships

    • Identification of conserved domains versus rapidly evolving regions

  • Synteny Analysis:

    • Examination of gene neighborhood conservation around nrm

    • Identification of potential gene duplications or losses

    • Assessment of chromosomal rearrangements affecting nrm locus

  • Expression Pattern Comparison:

    • Cross-species transcriptomic analysis of nrm expression

    • Identification of conserved regulatory elements

    • Comparison of tissue-specific expression patterns

This evolutionary perspective is particularly valuable given that zebrafish and mammals diverged approximately 400-450 million years ago, allowing for identification of core conserved functions versus species-specific adaptations of the nrm gene .

How does nrm interact with other nuclear envelope proteins in the zebrafish model?

Investigation of nrm interactions with other nuclear envelope components can be approached through:

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with tagged nrm versions

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

    • Yeast two-hybrid screening using nrm domains as bait

  • Localization Studies:

    • Super-resolution microscopy to precisely map nrm localization

    • Co-localization analysis with known nuclear envelope markers

    • FRET/FLIM approaches to assess direct interactions

  • Functional Relationship Analysis:

    • Genetic interaction studies through combined knockdown/knockout approaches

    • Complementation tests with other nuclear envelope gene mutations

    • Synthetic lethality screening to identify functional partners

These methodologies leverage the zebrafish model's advantages, including optical transparency for advanced imaging techniques and genetic tractability for manipulation of multiple genes .

What are common challenges in recombinant zebrafish Nurim expression and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant zebrafish Nurim:

ChallengePotential Solutions
Low expression yieldOptimize codon usage for expression system; test different promoters; adjust induction conditions
Protein aggregationScreen multiple detergents; add stabilizing agents; reduce expression temperature
Improper membrane integrationUse mammalian expression systems (e.g., HEK293T); verify signal sequence functionality
Protein degradationAdd protease inhibitors; optimize purification speed; validate storage conditions
Tag interference with functionTest multiple tag positions (N-terminal vs. C-terminal); use smaller tags; include linker sequences

Based on mouse Nurim expression protocols, maintaining protein stability requires careful buffer optimization, including components like 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol, with storage at -80°C to prevent degradation .

How should researchers interpret conflicting data between zebrafish nrm studies and mammalian models?

When facing data discrepancies between zebrafish and mammalian nrm studies:

  • Systematic Evaluation Process:

    • Analyze experimental design differences (developmental stages, tissue types, methodologies)

    • Assess species-specific paralog existence and potential functional divergence

    • Consider differences in nuclear envelope composition between species

  • Reconciliation Strategies:

    • Perform direct comparative studies using identical methodologies

    • Develop equivalent genetic models (e.g., equivalent mutations in both systems)

    • Apply cross-species rescue experiments to test functional conservation

  • Biological Interpretation:

    • Consider evolutionary divergence (400-450 million years) as a source of functional differences

    • Evaluate tissue-specific contexts that might influence nrm function

    • Assess potential differences in protein interaction networks

This approach acknowledges both the value of zebrafish as a model organism and the importance of recognizing species-specific differences in nuclear envelope biology .

What quality control measures are essential when working with recombinant zebrafish Nurim?

Critical quality control measures for recombinant zebrafish Nurim include:

  • Purity Assessment:

    • SDS-PAGE with Coomassie blue staining (target >80% purity)

    • Mass spectrometry to confirm protein identity and detect contaminants

    • Size-exclusion chromatography to assess aggregation state

  • Functional Verification:

    • Binding assays with known interaction partners

    • Secondary structure analysis via circular dichroism

    • Thermal stability testing to confirm proper folding

  • Batch Consistency:

    • Consistent yield between production batches

    • Reproducible activity in functional assays

    • Stable storage conditions to maintain activity

  • Contaminant Testing:

    • Endotoxin testing for mammalian cell applications

    • Nuclease/protease activity assays to detect enzymatic contaminants

    • Host cell protein analysis for expression system contaminants

These quality control measures ensure experimental reproducibility and reliability, particularly important when comparing results across different studies or laboratories.

How might single-cell technologies advance our understanding of zebrafish nrm function?

Single-cell technologies offer unprecedented opportunities for nrm functional analysis:

  • Single-Cell Transcriptomics:

    • Reveal cell type-specific nrm expression patterns during development

    • Identify co-expressed gene networks across different cell populations

    • Track temporal dynamics of nrm expression during cellular processes

  • Single-Cell Proteomics:

    • Map nrm protein levels at single-cell resolution

    • Correlate nrm abundance with nuclear morphology parameters

    • Identify cell populations with unique nrm modification patterns

  • Single-Cell Imaging Technologies:

    • Track nrm dynamics during cell cycle progression in vivo

    • Visualize nuclear envelope reorganization during developmental processes

    • Measure biophysical properties of nuclei in relation to nrm levels

  • Integration with Spatial Technologies:

    • Combine single-cell data with spatial information

    • Map nrm expression patterns in tissue context

    • Correlate nuclear envelope properties with tissue architecture

These technologies can leverage zebrafish advantages, including optical transparency and the ability to track individual cells during development .

What are the implications of nrm in zebrafish models of human disease?

Zebrafish nrm research has potential implications for human disease studies:

  • Nuclear Envelopathies:

    • Investigate nrm as a potential modifier of nuclear envelope diseases

    • Develop zebrafish models for nuclear envelope-related disorders

    • Screen for compounds that modify nuclear envelope dysfunction

  • Cancer Research:

    • Explore nrm's potential role in nuclear envelope changes during malignant transformation

    • Investigate connections between nuclear morphology and metastatic potential

    • Develop high-throughput screening platforms for compounds affecting nuclear integrity

  • Immune Disorders:

    • Study potential links between nuclear envelope dynamics and immune cell function

    • Utilize zebrafish innate immune response window (before 4-6 weeks) to isolate specific pathways

    • Investigate nuclear reorganization during immune cell activation

Zebrafish models provide unique advantages for these studies, including rapid development, genetic tractability, and the ability to perform large-scale chemical screens in vivo .

How can emerging CRISPR technologies expand zebrafish nrm research capabilities?

Advanced CRISPR technologies opening new avenues for zebrafish nrm research include:

  • Base Editing and Prime Editing:

    • Introduction of precise point mutations without double-strand breaks

    • Creation of specific amino acid substitutions to study structure-function relationships

    • Generation of disease-relevant mutations with minimal off-target effects

  • CRISPR Activation/Interference (CRISPRa/CRISPRi):

    • Modulation of nrm expression levels without permanent genetic changes

    • Tissue-specific or temporal control of nrm expression

    • Investigation of dose-dependent effects through tunable expression systems

  • CRISPR Screening Approaches:

    • Pooled screening for genetic interactors with nrm

    • Identification of synthetic lethal interactions

    • Discovery of enhancers or suppressors of nrm-related phenotypes

  • CRISPR-Based Imaging:

    • Visualization of the nrm genomic locus in living cells

    • Tracking of chromatin reorganization during development

    • Correlation of gene position with expression patterns

These technologies expand the zebrafish toolkit beyond traditional knockout approaches, enabling more sophisticated studies of nrm biology within its native genomic and cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.