Recombinant Danio rerio Oligosaccharyltransferase complex subunit ostc (ostc)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Oligosaccharyltransferase Complex Subunit Ostc (Ostc)

Oligosaccharyltransferase (OST) is a highly conserved membrane protein complex that plays a crucial role in the N-linked glycosylation pathway, a process essential for protein folding, stability, and function in eukaryotic cells . Within the OST complex, the subunit Ostc (oligosaccharyltransferase complex subunit Ostc) functions as a non-catalytic component . Specifically, Ostc is a component of the STT3A-containing form of the OST complex .

The Role of Ostc in the OST Complex

The OST complex requires multiple subunits to carry out its functions effectively . These functions include:

  • Positioning near the translocon pore

  • Recognizing and binding oligosaccharyldolichol

  • Scanning the nascent protein to recognize and bind sequons

  • Moving substrates into proper locations and conformations

  • Activating the Asn amide nitrogen atom for oligosaccharide transfer

  • Releasing substrates

Experimental Findings and Research

Research indicates that non-catalytic subunits, such as Ostc, play crucial roles in modulating N-glycosylation efficiency for certain precursors . Studies involving subunit-specific knockdowns have shown that OST48 and DAD1 are essential for the assembly of both STT3A- and STT3B-containing OST complexes . The knockdown of KCP2, another OST subunit, results in substrate-specific effects on N-glycosylation .

Clinical Significance and Glycosylation Disorders

Defects in the glycosylation pathway lead to congenital disorders of glycosylation (CDG) syndromes . Type I CDG syndromes result from defects in enzymes involved in the assembly or transfer of the Glc3Man9GlcNAc2-dolichol precursor, while Type II CDG syndromes involve defects occurring after the action of OST or in O-linked glycosylation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ostc; zgc:56559; Oligosaccharyltransferase complex subunit ostc
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ostc
Target Protein Sequence
METLFSLPFTVLECPNVKLKKPSWLHMPSAMTVYAVVIVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function

This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation, a process that occurs cotranslationally. The complex associates with the Sec61 complex at the translocon, the channel-forming complex mediating protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for optimal enzyme activity.

Database Links

KEGG: dre:393239

STRING: 7955.ENSDARP00000052004

UniGene: Dr.3685

Protein Families
OSTC family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of OSTC in zebrafish?

OSTC (Oligosaccharyltransferase Complex Non-Catalytic Subunit) functions as a specific component of the STT3A-containing form of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2)) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains . This represents the critical first step in protein N-glycosylation. In zebrafish, as in other vertebrates, the OSTC protein is required for maximal enzymatic activity of the OST complex, with N-glycosylation occurring cotranslationally as the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) .

How conserved is the OSTC protein sequence between zebrafish and other vertebrates?

BLAST search results demonstrate remarkable evolutionary conservation of the OSTC protein across vertebrate species. The zebrafish (Danio rerio) OSTC protein shows high sequence similarity with OSTC from other vertebrates, including Xenopus, chicken, bovine, rat, mouse, canine, and human homologs . This high degree of conservation reflects the fundamental importance of this protein in the N-glycosylation process across vertebrate evolution. Specifically, zebrafish OSTC shows very high alignment scores with human OSTC (bit score of 211, E-value of 1e-54) , indicating significant structural and functional conservation that makes zebrafish an excellent model organism for studying OSTC function in a system relevant to human biology.

What are the gene identifiers and aliases for zebrafish OSTC?

The zebrafish OSTC gene can be identified through various database resources. While the search results don't explicitly provide all zebrafish-specific identifiers, based on homology with human OSTC, researchers should be able to locate the gene through databases such as ZFIN (Zebrafish Information Network). The human OSTC homolog is identified by the following identifiers, which can be used as reference points for finding the zebrafish ortholog: HGNC ID: 24448; NCBI Gene ID: 58505; Ensembl ID: ENSG00000198856; UniProtKB/Swiss-Prot: Q9NRP0 . The zebrafish ortholog is associated with UniProt ID: Q7ZWJ3 .

What is known about the expression pattern of ostc in developing zebrafish embryos?

While the search results don't specifically detail the expression pattern of ostc in zebrafish embryos, we can infer that it would likely follow patterns similar to other components of the N-glycosylation machinery. For investigating expression patterns, researchers should consider employing techniques such as whole-mount in situ hybridization using antisense RNA probes specific to ostc transcripts. This approach would reveal spatial and temporal expression during development. Based on the function of OSTC in the oligosaccharyltransferase complex, which is critical for protein N-glycosylation throughout the body, expression would likely be ubiquitous but potentially enriched in tissues with high secretory activity.

To analyze expression patterns, researchers can generate transgenic zebrafish lines that express fluorescent reporters under the control of the ostc promoter, similar to the approach used with other zebrafish genes such as trap:GFP and osterix:mCherry described in the search results .

How do I design transgenic zebrafish models to study OSTC function?

Creating transgenic zebrafish models for studying OSTC requires careful planning and execution. Based on established methodologies for generating transgenic zebrafish lines, researchers should follow these steps:

  • Promoter selection and cloning: Isolate the upstream regulatory region of the zebrafish ostc gene (approximately 4-6 kb) using PCR amplification from genomic DNA with appropriate primers designed based on the zebrafish genome assembly.

  • Reporter selection: Construct a plasmid containing the ostc promoter driving expression of a fluorescent reporter gene (GFP, mCherry, etc.) with appropriate subcellular localization tags if desired.

  • Transgenesis method: Use the Tol2 transposon system for efficient integration. Co-inject the plasmid construct with Tol2 transposase mRNA into 1-cell stage zebrafish embryos.

  • Screening: Identify potential founders by screening for fluorescence expression in F0 embryos, then establish stable lines by breeding F0 adults and screening their progeny for germline transmission.

This approach parallels methods used for generating the trap:GFP and osterix:mCherry transgenic lines described in the search results , which states: "Transgenic zebrafish were generated by injection of the plasmid construct with TPase mRNA into 1-cell stage embryos. A stable transgenic line was obtained by screening of GFP or mCherry expression in F1 generation."

What are the optimal methods for recombinant expression and purification of zebrafish OSTC protein?

For recombinant expression and purification of zebrafish OSTC protein, researchers should consider these methodological steps:

  • Gene synthesis and cloning: Synthesize the zebrafish ostc coding sequence (based on sequences available in databases like UniProt: Q7ZWJ3) with appropriate codon optimization for the chosen expression system. Clone this sequence into a suitable expression vector with an affinity tag (His6, GST, etc.).

  • Expression system selection: Since OSTC is a membrane-associated protein that functions in the oligosaccharyltransferase complex, mammalian expression systems (HEK293, CHO) or insect cell systems (Sf9, High Five) are generally preferable to bacterial systems to ensure proper folding and post-translational modifications.

  • Purification strategy: Use a two-step purification approach:

    • Affinity chromatography using the tag incorporated into the recombinant protein

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Detergent considerations: Include appropriate detergents (e.g., digitonin, DDM, or LMNG) throughout the purification process to maintain protein solubility and stability, as OSTC is associated with membrane complexes.

  • Quality control: Assess purity by SDS-PAGE and confirm identity by Western blotting and/or mass spectrometry. Evaluate protein folding using circular dichroism spectroscopy.

What statistical approaches are recommended for analyzing zebrafish experiments involving OSTC?

When analyzing zebrafish experiments involving OSTC, particularly those examining phenotypic effects or behavioral responses, sophisticated statistical approaches are necessary to account for experimental variables:

  • Generalized Linear Mixed Models (GLMM): This approach is particularly valuable for analyzing imbalanced data and accounting for well-location effects in multi-well plate experiments . For locomotor behavior experiments, transforming activity values to binary responses (movement vs. no movement) can reduce data imbalance issues.

  • Data transformation considerations: As noted in the search results, "By addressing the data-imbalance and location-correlation issues, the GLMM effectively quantified true biological effects on zebrafish locomotor response" .

  • Recommended workflow:

    • Transform raw data to address imbalance issues

    • Apply GLMM to account for random effects (well position, plate effects)

    • Conduct appropriate post-hoc tests for specific comparisons

    • Generate visualizations that accurately represent both the data and statistical significance

  • Software implementation: Conduct statistical analyses using R software (version 3.2.3 or newer), with packages specifically designed for mixed-effects models .

How can CRISPR/Cas9 technology be utilized to study OSTC function in zebrafish?

CRISPR/Cas9 technology offers powerful approaches for studying OSTC function in zebrafish through targeted gene modification:

Based on the search results, this approach has been successful in zebrafish: "Efficiency of rankl knockdown was examined in the adult fin by qPCR using two different sets of primers that recognize gRNA target sites of rankl gene. We detected ~60–90% reduction of rankl expression by each primer set in all seven individual animals tested" .

How does OSTC contribute to zebrafish fracture healing and bone development?

While the search results don't specifically address OSTC's role in fracture healing, they provide context about zebrafish bone research that can guide OSTC investigations:

The zebrafish scale offers an excellent model for studying bone development and fracture healing. Research has shown that during fracture healing in zebrafish scales, there is significant communication between osteoblasts (OBs) and osteoclasts (OCs) . This communication involves extracellular vesicles (EVs) and signaling molecules that regulate bone resorption and formation.

To investigate OSTC's potential role in this process, researchers could:

  • Track OSTC expression: Examine ostc expression changes during fracture healing using qPCR and in situ hybridization.

  • Visualize OSTC trafficking: Create an ostc:fluorescent-protein fusion transgenic line to track the protein's localization during bone development and repair.

  • Assess glycosylation effects: Given OSTC's role in the N-glycosylation machinery, analyze how disruption of ostc affects glycosylation patterns of key bone development proteins like Rankl and other bone matrix proteins.

  • Investigate in fracture models: Apply the established fracture healing model described in the search results: "In order to induce fracture stress in the scale, the epidermis area of the scale was cut with fine scissors and confocal imaging was performed at 2 days post-fracture (dpf)" .

What is known about the role of OSTC in zebrafish embryonic development and organogenesis?

To investigate OSTC's developmental functions, researchers could employ:

  • Temporal expression analysis: Examine ostc expression at different developmental stages using qPCR and in situ hybridization to identify critical periods.

  • Tissue-specific knockout: Use tissue-specific CRISPR/Cas9 approaches to disrupt ostc function in specific tissues during development.

  • Rescue experiments: In ostc-deficient embryos, attempt rescue with wild-type ostc mRNA or tissue-specific transgene expression to determine when and where OSTC function is required.

  • Glycoprotein profiling: Compare the N-glycoproteome between wild-type and ostc-deficient embryos at different developmental stages to identify key OSTC-dependent glycoproteins critical for development.

Given that N-glycosylation affects numerous secreted and membrane proteins, OSTC disruption would likely cause pleiotropic developmental defects, potentially similar to other glycosylation pathway mutations.

How does zebrafish OSTC compare to human OSTC in terms of structure and function?

Zebrafish OSTC shares significant homology with human OSTC, suggesting conserved structure and function:

  • Sequence similarity: BLAST search results indicate high sequence similarity between zebrafish and human OSTC proteins (bit score of 211, E-value of 1e-54) , demonstrating evolutionary conservation.

  • Functional conservation: Both human and zebrafish OSTC proteins function as components of the oligosaccharyltransferase complex involved in N-glycosylation. This process is highly conserved across vertebrates.

  • Structural features: While specific structural comparisons are not detailed in the search results, the high sequence similarity suggests conserved protein topology and domain organization between human and zebrafish OSTC.

  • Complex assembly: In both species, OSTC functions as part of the OST complex. The human OSTC is specifically described as a "component of the STT3A-containing form of the oligosaccharyl transferase (OST) complex" , and the zebrafish ortholog likely assembles similarly.

  • Experimental relevance: The high conservation makes zebrafish an excellent model for studying OSTC function relevant to human biology and disease.

Can zebrafish OSTC models provide insights into human glycosylation disorders?

Zebrafish models of OSTC dysfunction offer valuable potential for studying human glycosylation disorders:

  • Model development: Create zebrafish ostc mutants using CRISPR/Cas9 gene editing to recapitulate features of human congenital disorders of glycosylation (CDGs).

  • Phenotypic analysis: Characterize developmental, structural, and functional consequences of ostc disruption, focusing on systems affected in human CDGs:

    • Nervous system development

    • Skeletal formation

    • Cardiovascular function

    • Muscle development

  • Drug screening applications: Use ostc-deficient zebrafish for high-throughput screening of compounds that might rescue glycosylation defects, leveraging methodologies for zebrafish behavioral analysis described in the search results .

  • Specific human mutations: Introduce specific human OSTC mutations associated with disease into the zebrafish ortholog using precision genome editing to create accurate disease models.

  • Glycoprotein profiling: Compare N-glycoproteome changes in ostc-mutant zebrafish with those observed in samples from patients with glycosylation disorders to identify conserved molecular signatures.

The transparency of zebrafish embryos makes them particularly valuable for real-time visualization of developmental processes affected by glycosylation defects, complementing biochemical and genetic analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.