Recombinant Danio rerio Opsin-1, short-wave-sensitive 1 (opn1sw1)

Shipped with Ice Packs
In Stock

Description

UV Light Detection

  • opn1sw1 is expressed in UV-sensitive cone photoreceptors, enabling detection of wavelengths ≤360 nm .

  • In larval zebrafish, UV cones with opn1sw1 exhibit:

    • 5× larger mitochondrial-rich ellipsoid bodies for enhanced phototransduction .

    • 40× greater synaptic calcium response amplitudes compared to ventral cones .

    • Specialization for prey capture in the upper frontal visual field .

Photoreceptor Maintenance

  • Essential for organizing cone outer segments in the ventral retina .

  • Regulates membrane protein localization and abundance in photoreceptors .

Experimental Tools

  • Antibodies: Polyclonal antibodies (e.g., Rabbit anti-opn1sw1) enable protein localization via immunohistochemistry .

  • Transgenic Models: BAC transgenes with fluorescently tagged opsins track trafficking and outer segment dynamics .

Disease Relevance

  • Human ortholog OPN1SW mutations cause tritanopia (blue-yellow color blindness) .

  • Zebrafish studies using recombinant opn1sw1 provide insights into cone degeneration mechanisms .

Comparative Analysis with Zebrafish Red Opsins

Featureopn1sw1 (UV-sensitive)opn1lw1/opn1lw2 (Red-sensitive)
Spectral Sensitivity≤360 nm (UV) 560–570 nm (Long-wave)
Expression OnsetEarly larval stages Juvenile stages (2 weeks post-fertilization)
Mitochondrial EnlargementPresent in UV cones Absent in red cones
Calcium Signaling10–40× regional variability Uniform response profiles

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
opn1sw1; opn1sw2; sws1; uvops; Opsin-1, short-wave-sensitive 1; Opsin SWS-1; Ultraviolet cone photoreceptor pigment; Ultraviolet-sensitive opsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
opn1sw1
Target Protein Sequence
MDAWAVQFGNASKVSPFEGEQYHIAPKWAFYLQAAFMGFVFIVGTPMNGIVLFVTMKYKK LRQPLNYILVNISLAGFIFDTFSVSQVFVCAARGYYFLGYTLCAMEAAMGSIAGLVTGWS LAVLAFERYVVICKPFGSFKFGQGQAVGAVVFTWIIGTACATPPFFGWSRYIPEGLGTAC GPDWYTKSEEYNSESYTYFLLITCFMMPMTIIIFSYSQLLGALRAVAAQQAESESTQKAE REVSRMVVVMVGSFVLCYAPYAVTAMYFANSDEPNKDYRLVAIPAFFSKSSCVYNPLIYA FMNKQFNACIMETVFGKKIDESSEVSSKTETSSVSA
Uniprot No.

Target Background

Function
Visual pigments, crucial for vision, are light-absorbing molecules composed of an opsin apoprotein covalently bound to cis-retinal.
Gene References Into Functions
  1. Characterized cis-acting DNA sequences regulating the cell type-specific expression of the zebrafish UV cone pigment gene. PMID: 14966125
  2. In Pacific salmon, all single cones in the retina's non-growth zones express blue opsin, while double cone opsin expression exhibits an alternating pattern within the square mosaic unit. PMID: 17592670
Database Links

KEGG: dre:30582

STRING: 7955.ENSDARP00000067159

UniGene: Dr.8194

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Retinal short single cones, outer and inner segments.

Q&A

What is the spectral sensitivity and functional role of opn1sw1 in zebrafish vision?

Zebrafish opn1sw1 encodes a UV-sensitive opsin with peak spectral sensitivity at approximately 355 nm (ultraviolet wavelength) . This opsin is specifically expressed in the ultraviolet-sensitive cone photoreceptors in zebrafish retina, forming a critical component of the animal's color vision system. The UV cones correspond to the short single cones in the highly organized retinal mosaic .

Functionally, the UV-sensitive cones contribute to specific aspects of zebrafish vision, participating in specialized retinal circuits that differ from those associated with other cone subtypes . The UV-sensitive photoreceptors contribute to behaviors related to prey detection, predator avoidance, and mate selection in the aquatic environment where UV light penetrates the water column.

How is opn1sw1 expression regulated during zebrafish retinal development?

Opn1sw1 expression occurs within a precisely coordinated developmental program that establishes the stereotyped row mosaic pattern characteristic of the zebrafish retina. This expression is regulated by multiple transcription factors that control photoreceptor subtype specification . The expression can be visualized using transgenic reporter lines such as Tg(-5.5opn1sw1:EGFP)kj9, which express GFP in UV cones under the control of the SWS1 opsin promoter .

Research has demonstrated that unlike many mammalian species that lost certain cone subtypes during evolution, zebrafish have maintained a diverse complement of photoreceptors, including the UV-sensitive cones expressing opn1sw1 . The regulatory mechanisms controlling this expression are part of the broader transcriptional networks that establish photoreceptor diversity and are becoming better understood through transcriptomic profiling of specific photoreceptor populations.

What methods are most effective for generating opn1sw1 knockout zebrafish?

CRISPR/Cas9 gene editing has proven highly effective for generating opn1sw1 knockout zebrafish. The methodology involves:

  • Design of guide RNAs targeting specific regions of the opn1sw1 gene

  • Injection of guide RNAs and Cas9 protein into 1-cell stage zebrafish embryos

  • Rearing of injected animals to adulthood

  • Screening of F1 offspring for inheritance of mutant alleles

Recent successful approaches have used synthetic guide RNAs obtained from commercial sources (such as IDT) together with Cas9 protein for microinjection. This ribonucleoprotein complex approach often yields higher editing efficiency than plasmid-based methods .

For targeted deletion of specific exons, the targeting construct should be designed to remove crucial coding regions. For example, in mouse models, a targeting construct designed to delete exons 2, 3, and 4 of the Opn1sw gene has been used successfully to create S-opsin knockouts .

How can researchers effectively screen and validate opn1sw1 mutant lines?

A systematic approach to screening and validating opn1sw1 mutant lines includes:

  • DNA extraction from F1 offspring followed by PCR amplification of the targeted region of the opn1sw1 locus

  • Purification of PCR products using commercial kits (e.g., Omega Bio-Tek)

  • Sequencing to detect inheritance of novel alleles

  • Outcrossing F1 carriers with wild-type fish to isolate and verify mutant alleles

  • Inbreeding of F1 heterozygous carriers to produce homozygous larvae for phenotypic analysis

For phenotypic validation, F2 offspring can be mated to transgenic sws1:eGFP reporter fish. The resulting embryos, which express eGFP in UV-sensitive cones, can be treated with 1-phenyl 2-thiourea (PTU) to inhibit pigmentation during embryogenesis, allowing clear visualization of cone patterns using fluorescence microscopy .

Another validation approach involves reverse transcriptase PCR (RT-PCR) to confirm the absence of normal opn1sw1 transcripts, as demonstrated in mouse models with S-opsin knockouts .

What phenotypes are typically observed in opn1sw1 knockout zebrafish?

Homozygous opn1sw1 mutants typically display:

  • Absence of UV-sensitive cone function

  • Alterations in photoreceptor morphology, particularly in UV cones

  • Progressive photoreceptor dysfunction and potential cell death

The phenotype severity may depend on the nature of the mutation and the specific exons affected. For instance, mutations causing premature stop codons lead to complete loss of functional protein .

Unlike some opsin knockout models where one cone opsin may substitute for another, complete deletion of opn1sw1 results in a specific loss of UV sensitivity without compensation from other opsins. This creates a cleaner phenotype for studying the specific role of UV vision in zebrafish behavior and physiology.

What transcription factors regulate opn1sw1 expression in zebrafish?

Recent deep transcriptomic profiling of zebrafish photoreceptor subtypes has revealed multiple transcription factors that potentially regulate UV cone-specific gene expression, including opn1sw1. This research has employed RNA-seq of FACS-sorted photoreceptor populations to achieve unprecedented depth of coverage - approximately 10.19 million mapped reads per sample, corresponding to an average of 7,936 unique genes per sample .

While specific transcription factors exclusively controlling opn1sw1 expression are still being fully characterized, the regulatory mechanisms likely involve combinations of transcription factors that create and maintain differences between photoreceptor subtypes. These factors are part of gene regulatory networks that control both the initial specification of UV cones and the maintenance of their identity throughout the animal's life .

The tSNE clustering of photoreceptor subtypes based on transcriptomic profiles shows that UV cones expressing opn1sw1 have distinct gene expression signatures that separate them from other cone types, suggesting unique transcriptional regulation .

How can RNA-seq be optimized for studying opn1sw1 expression patterns?

For optimal RNA-seq analysis of opn1sw1 expression, researchers should consider:

  • Isolation of pure UV cone populations using transgenic reporter lines (e.g., Tg(-5.5opn1sw1:EGFP)kj9)

  • Fluorescence-activated cell sorting (FACS) to obtain homogeneous cell populations

  • High-quality RNA extraction procedures optimized for small cell numbers

  • Deep sequencing to achieve comprehensive coverage (10+ million mapped reads per sample)

  • Unsupervised clustering analysis (e.g., tSNE) to verify sample identity and distinguish between photoreceptor subtypes

This approach provides substantially deeper transcriptomes compared to single-cell droplet-based techniques, with more than 2,000-fold differences in sequencing depth . Such deep profiling enables detection of low-abundance transcripts that might be missed in single-cell RNA-seq experiments.

What is the relationship between opn1sw1 and other opsin genes in the zebrafish genome?

Zebrafish possess a diverse complement of cone opsin genes that function in distinct photoreceptor subtypes:

Opsin GenePhotoreceptor TypeSpectral Sensitivity (λ max)Location in Mosaic
opn1sw1UV cones355 nmShort single cones
opn1sw2S cones415 nmLong single cones
opn1mw1-4M cones467-505 nmAccessory double cones
opn1lw1-2L cones548-558 nmPrincipal double cones
rhoRods501 nmN/A (not in mosaic)

These opsin genes are arranged in a precise ratio within the retinal mosaic, where rows of red-/green-sensitive double cone pairs alternate with rows of blue- and UV-sensitive single cones . This arrangement creates a crystalline-like pattern that is highly stereotyped in zebrafish.

The expression patterns of these genes are distinct, with each cone subtype expressing its characteristic opsin(s). The M opsin genes (opn1mw1-4) show region-specific expression patterns within the retina, while opn1sw1 expression is more uniform across the UV cone population .

How can opn1sw1 research in zebrafish inform gene therapy approaches for human vision disorders?

While opn1sw1 research in zebrafish primarily focuses on UV-sensitive cones, the principles and methodologies have direct translational relevance to human vision disorders, particularly those affecting cone photoreceptors. Studies with other opsin genes have demonstrated that:

  • AAV-mediated gene augmentation therapy can rescue cone structure and function in mouse models with congenital opsin deletions

  • The effectiveness of gene therapy depends significantly on the timing of intervention, with earlier treatment yielding better outcomes

  • Cones lacking complete opsin expression from birth can benefit from gene therapy up to a certain age window, after which rescue effectiveness diminishes

These findings from mouse models have implications for treating human conditions like blue cone monochromacy (BCM). By extension, research on opn1sw1 in zebrafish could inform approaches to treating S-cone specific disorders in humans, as the fundamental molecular mechanisms of photoreceptor function and degeneration are often conserved across vertebrates.

The zebrafish opn1sw1 model provides a valuable system for testing gene delivery vectors, optimizing treatment windows, and assessing long-term rescue of cone function prior to clinical translation .

What are the most effective viral vectors for delivering recombinant opn1sw1 in rescue experiments?

Based on related research with other opsin genes, adeno-associated virus (AAV) vectors have emerged as the preferred delivery system for opsin gene therapy. Key considerations include:

  • AAV serotype selection - different serotypes show varying tropism for photoreceptor cells

  • Promoter selection - cell-specific promoters ensure targeted expression in UV cones

  • Packaging capacity - standard AAVs accommodate approximately 4.7 kb, sufficient for most opsin expression cassettes

  • Subretinal injection technique - precise delivery to photoreceptor layer is critical for successful transduction

In mouse models of opsin deletion, subretinal injection of AAV vectors expressing human opsin promoted cone outer segment regeneration and rescued cone-mediated function . Similar approaches could be applied to rescue opn1sw1 function in zebrafish models.

The timing of intervention appears critical - in mouse models, AAV-mediated rescue was most effective when animals were treated at younger ages (2 months or earlier), while treatment at later stages (5-7 months) showed significantly reduced effectiveness despite the continued presence of cone cells .

How can CRISPR-based F0 screening be used to efficiently test transcription factors regulating opn1sw1?

CRISPR-based F0 screening offers an efficient platform for testing the function of transcription factors that potentially regulate opn1sw1 expression. The methodology involves:

  • Identification of candidate transcription factors from RNA-seq data of UV cone photoreceptors

  • Design of guide RNAs targeting these transcription factors

  • Injection of guide RNAs and Cas9 into embryos carrying UV cone reporter transgenes (e.g., Tg(-5.5opn1sw1:EGFP)kj9)

  • Direct assessment of UV cone development and opn1sw1 expression in injected F0 embryos

  • Quantification of phenotypic effects without the need for germline transmission

This approach has been benchmarked by successfully replicating known phenotypes and has proven reliable for rapidly testing multiple candidate genes . The advantage of F0 screening is that it bypasses the time-consuming process of establishing stable mutant lines, allowing researchers to efficiently test numerous transcription factors for their roles in regulating opn1sw1.

What histological methods provide optimal visualization of opn1sw1-expressing cells?

For optimal visualization of opn1sw1-expressing cells, researchers can employ:

  • Transgenic reporter lines: Tg(-5.5opn1sw1:EGFP)kj9 expressing GFP in UV cones provides direct visualization of opn1sw1-expressing cells

  • Fluorescent in situ hybridization:

    • Use of digoxigenin-labeled riboprobes against opn1sw1

    • Multiplex fluorescent detection technology for simultaneous visualization of multiple opsin types

    • Counterstaining with photoreceptor markers to identify cone subtypes

  • Immunohistochemistry:

    • Antibodies against the opn1sw1 protein or GFP in transgenic lines

    • Combination with cone morphology markers

  • Sample preparation techniques:

    • Treatment with PTU (1-phenyl-2-thiourea) to block melanin pigmentation

    • Dissection of neural retina from dark-adapted fish

    • Fixation in 4% paraformaldehyde with 5% sucrose in phosphate-buffered saline

    • Mounting in glycerol-based p-phenylenediamine antifade medium

These methods can be applied to both larval zebrafish (typically at 3-7 days post-fertilization) and adult retinas to examine developmental and mature expression patterns of opn1sw1.

What approaches can resolve contradictory data regarding opn1sw1 compensation mechanisms?

When confronting contradictory data regarding opn1sw1 compensation mechanisms (e.g., whether other opsins can compensate for its loss), researchers should consider these methodological approaches:

  • Comprehensive transcriptomic analysis:

    • Compare RNA-seq profiles of wild-type and opn1sw1 knockout retinas

    • Analyze all opsin gene expression levels to detect potential compensatory upregulation

    • Use both bulk RNA-seq and single-cell approaches to capture cell-type specific changes

  • Functional assessments:

    • Electroretinography (ERG) with specific wavelength stimuli to isolate cone subtype responses

    • Behavioral assays that specifically depend on UV vision

    • Optomotor response testing using UV wavelengths

  • Temporal analysis:

    • Examine potential compensation at multiple developmental timepoints

    • Consider that compensation mechanisms may change with age or progressive degeneration

  • Genetic approaches:

    • Generate compound mutants lacking multiple opsins to test redundancy hypotheses

    • Use inducible systems to distinguish between developmental compensation and acute responses

  • Imaging techniques:

    • Track individual cones longitudinally in transparent larval zebrafish

    • Use reporter lines to monitor potential changes in opsin expression patterns

By systematically applying these approaches, researchers can resolve apparently contradictory data and develop a more nuanced understanding of whether and how compensation occurs in response to opn1sw1 deficiency.

How does zebrafish opn1sw1 compare structurally and functionally with human SWS1 opsin?

Zebrafish opn1sw1 and human SWS1 opsin share fundamental structural and functional characteristics as members of the same opsin subfamily, though with notable differences:

  • Spectral sensitivity:

    • Zebrafish opn1sw1: λ max = 355 nm (UV range)

    • Human SWS1 (blue opsin): λ max = approximately 420 nm (blue range)

    This spectral shift reflects evolutionary adaptation to different visual environments, with humans having lost true UV sensitivity found in many non-mammalian vertebrates.

  • Expression patterns:

    • Zebrafish: Expressed in dedicated UV cones arranged in a precise mosaic pattern

    • Humans: Expressed in S-cones that constitute approximately 5-10% of the cone population, distributed in a semi-regular pattern

  • Evolutionary context:

    • Zebrafish retained the ancestral vertebrate complement of multiple cone subtypes

    • Mammals lost some of this diversity during nocturnal phases of evolution, preserving only rods and cone subtypes related to UV (S) and L cones

Despite these differences, research on zebrafish opn1sw1 can inform human vision studies, as the basic mechanisms of photoreceptor development, function, and degeneration are highly conserved. Mutations in homologous regions of different opsins often cause similar phenotypes, making zebrafish a valuable model for studying potential therapeutic approaches for human opsin-related disorders .

What can opn1sw1 knockout studies tell us about the evolutionary significance of UV vision?

Opn1sw1 knockout studies provide valuable insights into the evolutionary significance of UV vision by allowing researchers to:

  • Assess the specific behavioral deficits resulting from UV vision loss

  • Understand the selective pressures that maintained UV vision in some lineages

  • Examine potential compensatory mechanisms when UV vision is lost

In zebrafish, opn1sw1 knockouts can be used to study behaviors that specifically depend on UV sensitivity, such as prey detection, predator avoidance, and mate selection . The persistence of UV vision in zebrafish and other diurnal fish species suggests strong evolutionary pressure to maintain this capability in aquatic environments where UV light provides important visual information.

The study of homozygous opn1sw1 mutants reveals photoreceptor dysfunction and potential cell death , highlighting the integrated nature of photoreceptor development and maintenance. This integration suggests that loss of specific opsin functions during evolution likely involved coordinated changes in multiple genes to prevent detrimental effects on retinal health.

By comparing phenotypes across species with different evolutionary histories, researchers can gain insights into how visual systems adapted to diverse ecological niches and the consequences of gaining or losing specific spectral sensitivities during vertebrate evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.