Recombinant Danio rerio Opsin-1, short-wave-sensitive 2 (opn1sw2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Opsin-1, short-wave-sensitive 2 (opn1sw2)

Opsin-1, short-wave-sensitive 2 (opn1sw2) is a blue-sensitive cone photoreceptor pigment encoded by the opn1sw2 gene in zebrafish (Danio rerio). This G protein-coupled receptor facilitates short-wavelength light detection (∼440 nm) and is integral to color vision and phototaxis . Recombinant forms of this protein are produced for biochemical and functional studies, enabling researchers to dissect its role in visual pathways and circadian rhythms .

Gene and Protein Features

  • Gene ID: 30435 (ZFIN: ZDB-GENE-990604-40) .

  • Protein Length: 354 amino acids (UniProt: Q9W6A8) .

  • Domains: Seven transmembrane helices typical of rhodopsin-like receptors .

  • Post-Translational Modifications: N-terminal His-tag in recombinant forms for purification .

Sequence Highlights

The protein includes conserved residues critical for retinal binding (e.g., Lys-296) and a cytoplasmic domain involved in G-protein coupling .

Expression and Production

Recombinant opn1sw2 is synthesized using multiple expression systems:

Host SystemPurityTagApplications
E. coli/Yeast≥85%His-tagELISA, Western Blot
Mammalian Cells>80%His-tagStructural studies
Cell-Free Expression≥85%None/His-tagFunctional assays

Purification typically involves affinity chromatography, with endotoxin levels <1.0 EU/μg for mammalian-derived products .

Tissue-Specific Expression

  • Eye: Highly expressed in cone photoreceptors (outer nuclear layer) .

  • Brain: Detected in horizontal cells (INL) and retinal ganglion cells (RGCs) .

  • Pineal Gland: Co-expressed with circadian regulators like tmt3a and opn4m2 .

Functional Insights

  • Phototransduction: Mediates light-dependent Gαt signaling in blue-sensitive cones .

  • Non-Visual Roles: Regulates phototaxis and circadian entrainment via extraocular pathways .

Available Products

Product CodeSourceFormPrice
MBS7024563 E. coliLyophilized$1,709.00
CSB-CF895245DIL Cell-FreeLiquidCustom quote
OPN1SW2-8796Z Mammalian CellsLiquid/PowderInquiry-based

Experimental Uses

  • Antibody Production: Rabbit polyclonal antibodies validated for WB/ELISA .

  • Signal Pathway Analysis: Used in optogenetic studies to map blue-light responses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
opn1sw2; bluops; opn1sw1; sws2; Opsin-1, short-wave-sensitive 2; Blue cone photoreceptor pigment; Blue-sensitive opsin; Opsin SWS-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
opn1sw2
Target Protein Sequence
MKQQQQTPELFEDFHMPITLDVSNISAYSPFLVPQDHLGHSGVFMGMSAFMLFLFIAGTA INVLTIVCTIQYKKLRSHLNYILVNLAISNLWVSVFGSSVAFYAFYKKYFVFGPIGCKIE GFTSTIGGMVSLWSLAVVALERWLVICKPLGNFTFKTPHAIAGCILPWCMALAAGLPPLL GWSRYIPEGLQCSCGPDWYTTNNKFNNESYVMFLFCFCFAVPFSTIVFCYGQLLITLKLA AKAQADSASTQKAEREVTKMVVVMVFGFLICWGPYAIFAIWVVSNRGAPFDLRLATIPSC LCKASTVYNPVIYVLMNKQFRSCMMKMVFNKNIEEDEASSSSQVTQVSSVAPEK
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Gene References Into Functions
  1. A 0.3-kb region was identified between 0.6 and 0.3 kb 5' of the SWS2 initiation codon, encompassing four cone-rod homeobox-binding sites (OTX sequences). PMID: 18796431
Database Links

KEGG: dre:30435

STRING: 7955.ENSDARP00000019477

UniGene: Dr.81284

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Retinal long single cone outer segments.

Q&A

What is the expression pattern of opn1sw2 in zebrafish tissues?

Opn1sw2 (designated as sws2 in some literature) shows a distinct expression pattern across zebrafish tissues. According to comprehensive tissue profiling, opn1sw2 is highly expressed in the eye, particularly in the retina. In contrast to some opsins like rgr2 and sws1 which show consistent expression across multiple tissues, opn1sw2 exhibits more tissue-specific expression. Notably, the pineal gland shows high expression levels of opn1sw2 alongside other visual opsins such as rh1.1, lws1, lws2, and tmt3a, opn4m2, opn4x2, and opn6a .

When analyzing expression patterns, consider using quantitative methods like NanoString nCounter technology, which provides a complete analysis of opsin photopigment expression across tissues, revealing that while opn1sw2 is predominantly expressed in photosensitive organs, it may also be present at lower levels in other tissues.

How does opn1sw2 genetically relate to other visual opsins in the zebrafish genome?

Opn1sw2 belongs to one of the five classic classes of vertebrate visual pigment genes. In zebrafish, these classes include:

  • Rod opsin (rhodopsin-like-1; rh1)

  • Long-wavelength-sensitive (lws)

  • Short-wavelength-sensitive-1 (sws1)

  • Short-wavelength-sensitive-2 (sws2)

  • Rhodopsin-like-2 (rh2)

Through evolutionary gene duplication events, zebrafish have developed an increased repertoire of visual opsin family members. While some genes like lws (duplicated into lws1 and lws2), rh1 (duplicated), and rh2 (quadrupled into four genes) have undergone significant expansion, the sws2 gene (which encodes opn1sw2) has maintained its singularity in the zebrafish genome . Understanding this evolutionary context is crucial when designing experiments that compare opn1sw2 function with other opsins or when using it as a marker for specific photoreceptor types.

What cellular populations express opn1sw2 in the zebrafish retina?

In the zebrafish retina, opn1sw2 is primarily expressed in a specific subpopulation of cone photoreceptors. Unlike some of the novel opsins that show expression across multiple retinal cell types (such as opn8a in bipolar cells, opn8c and opn9 in horizontal cells, and opn7d in amacrine cells), opn1sw2 maintains a more restricted expression pattern typical of classical visual opsins .

The opn1sw2-expressing cone photoreceptors form part of the highly organized mosaic pattern characteristic of the zebrafish retina. When conducting immunohistochemistry or in situ hybridization experiments, you should expect to see opn1sw2 expression primarily in the photoreceptor layer, with protein localization specifically in the outer segments of these specialized cells.

What methods are most effective for quantifying opn1sw2 expression in zebrafish tissues?

For accurate quantification of opn1sw2 expression across zebrafish tissues, I recommend using a combination of approaches:

  • NanoString nCounter Analysis: This technology offers high sensitivity and reproducibility for quantifying RNA expression. As demonstrated in comprehensive opsin profiling studies, NanoString can effectively quantify opn1sw2 transcript levels across different tissues and developmental stages . This method is particularly valuable as it doesn't require amplification steps that might introduce bias.

  • RNA in situ Hybridization (R-ISH): For cellular resolution of opn1sw2 expression, R-ISH on tissue sections provides precise localization of transcripts. This approach is essential for determining the specific cell types expressing opn1sw2 within complex tissues like the retina .

  • RT-qPCR: For targeted analysis comparing opn1sw2 expression across experimental conditions, RT-qPCR offers a more accessible approach, though care must be taken in primer design to ensure specificity given the sequence similarity among opsin family members.

When designing experiments, include appropriate housekeeping genes as internal controls and, if possible, reference your expression data to known photoreceptor markers to contextualize your findings.

How can I generate a transgenic zebrafish line for studying opn1sw2 expression and protein trafficking?

Based on successful strategies for generating opsin transgenic lines, I recommend:

  • BAC Transgenic Approach: Utilizing a bacterial artificial chromosome (BAC) containing the complete opn1sw2 genomic locus with its native regulatory elements. This approach has been successful for other opsins like opn1lw1 and opn1lw2 . The BAC should include several kilobases of sequence upstream and downstream of the coding region to capture all relevant regulatory elements.

  • Fusion Protein Design: Create a fluorescent protein fusion that allows visualization of opn1sw2 trafficking and localization. Similar to successful rhodopsin-GFP fusions, design your construct to ensure the fluorescent tag doesn't interfere with proper folding, trafficking, or function of the opsin .

  • Validation Strategy:

    • Confirm expression pattern matches endogenous opn1sw2 using in situ hybridization

    • Verify correct subcellular localization to the outer segments of cone photoreceptors

    • Test functional properties of the fusion protein compared to native opn1sw2

When designing your construct, consider that unlike the red opsins (opn1lw1 and opn1lw2) which are arranged in tandem and share regulatory elements , opn1sw2 may have distinct regulatory requirements that need to be preserved in your transgenic construct.

What protocols yield functional recombinant opn1sw2 for in vitro studies?

For successful expression and characterization of functional recombinant opn1sw2:

  • Expression System Selection: Based on successful approaches with other zebrafish opsins, I recommend using either:

    • Mammalian cell lines (such as Neuro-2a cells) for functional characterization through electrophysiology and calcium imaging

    • HEK293 cells for spectral characterization and biochemical studies

  • Chromophore Reconstitution: Opn1sw2 likely forms a functional pigment with 11-cis retinal. When expressing recombinant opn1sw2:

    • Supplement expression media with 9-cis or 11-cis retinal (1-5 μM)

    • Perform experiments in dim red light to prevent chromophore isomerization

    • Allow 24-48 hours for chromophore incorporation and proper protein folding

  • Functional Verification:

    • UV-visible spectrophotometry to determine absorption characteristics and λmax

    • Patch-clamp recordings to measure light-evoked currents

    • Calcium imaging to assess G-protein coupling and downstream signaling

Remember that opn1sw2, like other visual opsins, is likely monostable (interacting primarily with 11-cis retinal), in contrast to some non-visual opsins that can be bistable (interacting with both 11-cis and all-trans retinal isomers) .

How do the spectral sensitivity and biochemical properties of opn1sw2 compare with other zebrafish visual opsins?

Opn1sw2, as its name suggests, is a short-wavelength-sensitive opsin with distinct spectral properties:

Opsin Typeλmax (nm)Chromophore PreferenceSpectral CharacterTypical G-protein Coupling
Opn1sw2~415-42511-cis retinalMonophasicTransducin (Gt)
Rh1.1~50011-cis retinalMonophasicTransducin (Gt)
Rh2.1-2.4~465-49511-cis retinalMonophasicTransducin (Gt)
Opn1sw1~355-36511-cis retinalMonophasicTransducin (Gt)
Opn1lw1/2~560-56511-cis retinalMonophasicTransducin (Gt)

Opn1sw2 belongs to the class of classical visual pigments that are monostable, forming stable complexes specifically with 11-cis retinal chromophore. This contrasts with some non-visual opsins like neuropsins and parapinopsins that demonstrate bistable properties, forming stable complexes with multiple retinal isomers .

When conducting spectral analyses using UV-visible spectrophotometry, you should expect opn1sw2 to exhibit a single absorption peak (monophasic profile) with maximum absorption in the blue-violet region of the spectrum, reflecting its role in color vision.

What are the signaling mechanisms and electrophysiological properties of opn1sw2 activation?

For electrophysiological characterization:

  • Patch-clamp Recording Protocol:

    • Express opn1sw2 in Neuro-2a cells (which lack endogenous retinal processing)

    • Supplement with 11-cis retinal to form functional pigment

    • Record light-evoked currents using whole-cell voltage clamp configuration

    • Test response to different wavelengths to confirm spectral sensitivity matches absorption spectrum

When conducting such experiments, chromophore-dependent activation of native calcium signaling pathways (typically through Gq/G11) can be observed in heterologous expression systems . Light-evoked functional currents should be optimally triggered by wavelengths corresponding to the λmax of opn1sw2 (~415-425 nm).

Unlike some novel opsins that can utilize both cis and trans isomers of retinal (e.g., Opn6a, Opn7a, Opn7b, Opn8a, and Opn8c), opn1sw2 likely follows the classical visual opsin pattern of primarily working with only cis forms of the chromophore .

How does opn1sw2 contribute to the spectral tuning and color vision of zebrafish?

Zebrafish possess a sophisticated color vision system with multiple cone types expressing different opsins. Opn1sw2 provides sensitivity to blue-violet wavelengths, complementing other cone types to enable tetrachromatic color vision:

  • Spectral Positioning: Opn1sw2 fills an important niche in the spectral sensitivity of zebrafish, covering wavelengths between the UV-sensitive opn1sw1 (λmax ~360 nm) and the green-sensitive rh2 opsins (λmax ~465-495 nm). This arrangement ensures broad spectral coverage with minimal gaps.

  • Developmental Regulation: Expression of opn1sw2 is developmentally regulated, coordinated with the maturation of the retina. The specific timing of opn1sw2 expression contributes to the establishment of functional color vision during development.

  • Ecological Relevance: The spectral sensitivity of opn1sw2 is adapted to the underwater light environment of zebrafish, which is rich in short-to-medium wavelengths after filtering through water. This adaptation highlights the evolutionary significance of maintaining this opsin class.

When designing experiments to study color vision, consider that opn1sw2-expressing cones likely participate in opponent processing with other cone types, particularly those expressing long-wavelength-sensitive opsins . This opponent processing is fundamental to color discrimination.

What are the common challenges in expressing and purifying recombinant opn1sw2?

Recombinant expression of opn1sw2 presents several challenges that require specific technical solutions:

  • Protein Misfolding: As a seven-transmembrane domain protein, opn1sw2 is prone to misfolding when overexpressed. To address this:

    • Use mammalian expression systems rather than bacterial systems

    • Include chaperone proteins in expression constructs

    • Maintain expression at lower temperatures (30-33°C instead of 37°C)

    • Add chemical chaperones such as 4-phenylbutyric acid to the culture medium

  • Chromophore Incorporation: Efficient formation of functional pigment requires proper chromophore incorporation. Challenges include:

    • Light sensitivity of retinal chromophores (perform all procedures under dim red light)

    • Limited solubility of retinal (use proper solubilization in ethanol before adding to aqueous media)

    • Incomplete chromophore binding (optimize incubation time and temperature)

  • Purification Stability: Maintaining functional opsin during purification is difficult. Strategies include:

    • Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Include retinal during purification to stabilize protein structure

    • Add phospholipids to maintain the native-like membrane environment

These technical challenges may account for why some opsins fail to generate functional pigments in spectroscopic assays despite showing activity in cellular functional assays , as was observed with Opn9 in the reference studies.

How can contradictory data between different assays of opn1sw2 function be reconciled?

When analyzing opn1sw2 function, you may encounter discrepancies between different experimental approaches. Here's how to reconcile these contradictions:

  • Sensitivity Differences Between Assays:

    • Electrophysiological methods (patch-clamp) typically offer higher sensitivity than spectroscopic methods

    • A pigment that fails to show absorbance changes in UV-vis spectrophotometry might still produce detectable light-evoked currents in patch-clamp recordings

  • Expression Level Variations:

    • Functional assays (calcium imaging, electrophysiology) can detect responses from low expression levels

    • Spectroscopic methods require higher protein concentrations to detect absorption above background

    • Normalize data to expression levels using techniques like western blotting with epitope tags

  • Reconciliation Approach:

    • Compare relative amplitudes of responses rather than absolute values

    • Consider the chromophore-dependence pattern across different assays

    • Implement multiple complementary techniques for comprehensive assessment

For example, in studies of novel opsins, Opn6a and Opn8c activated retinal-dependent, light-evoked currents in electrophysiology experiments but failed to generate detectable pigments by UV-vis spectrophotometry when all-trans retinal was used . This highlights the need for multiple experimental approaches when characterizing opsin properties.

What controls and validation steps are essential when studying opn1sw2 localization and trafficking?

For robust investigation of opn1sw2 localization and trafficking:

  • Essential Controls for Localization Studies:

    • Antibody Validation: Verify antibody specificity using opn1sw2-knockout tissue or Western blotting

    • Cross-Reactivity Check: Test for cross-reactivity with other opsins, particularly opn1sw1

    • Subcellular Markers: Include markers for outer segments (e.g., peripherin), connecting cilium (e.g., acetylated tubulin), and other cellular compartments

  • Transgenic Expression Validation:

    • Comparison to Endogenous Pattern: Verify that transgenic opn1sw2 expression matches the endogenous pattern using in situ hybridization

    • Functional Verification: Confirm that fluorescently tagged opn1sw2 forms functional pigment with appropriate spectral characteristics

    • Physiological Response: Demonstrate that the tagged protein can mediate light responses

  • Trafficking Dynamics Assessment:

    • Pulse-Chase Experiments: Track newly synthesized opsin from the ER through the secretory pathway to the outer segment

    • Photobleaching Recovery: Use FRAP (Fluorescence Recovery After Photobleaching) to measure the kinetics of opsin movement

    • Perturbation Analysis: Examine effects of cytoskeletal disruption or trafficking protein knockdown

When designing transgenes for studying opn1sw2 trafficking, consider the approach used for red opsins where BAC-based transgenes containing all regulatory elements facilitated expression of opsin fusion proteins that correctly localized to outer segments . This approach allows for visualizing protein dynamics during retinal development and maintenance.

How might CRISPR/Cas9 genome editing be optimized for studying opn1sw2 function in zebrafish?

CRISPR/Cas9 genome editing offers powerful approaches for studying opn1sw2 function in zebrafish:

  • Knock-in Strategy for Endogenous Tagging:

    • Design homology-directed repair templates to insert fluorescent tags at the C-terminus of endogenous opn1sw2

    • Use short homology arms (500-1000 bp) flanking the insertion site

    • Select gRNA target sites near the stop codon to minimize disruption of opsin function

    • Include flexible linker sequences to preserve protein folding and function

  • Regulatory Element Editing:

    • Target conserved transcription factor binding sites in the opn1sw2 promoter region

    • Create precise deletions of putative enhancer elements to map their contributions to expression patterns

    • Introduce reporter genes under control of isolated regulatory elements to test sufficiency

  • Functional Domain Mutagenesis:

    • Generate point mutations in key functional residues (chromophore binding pocket, G-protein interaction sites)

    • Create chimeric opsins by swapping domains between opn1sw2 and other opsins to map spectral tuning sites

    • Introduce human disease-associated mutations to develop models for cone disorders

When implementing CRISPR/Cas9 approaches, validate editing efficiency using sequencing, confirm phenotypes with rescue experiments, and consider potential off-target effects by sequencing predicted off-target sites.

What is the potential for using opn1sw2-expressing cells in optogenetic applications?

Opn1sw2 offers unique properties that could be valuable for optogenetic applications:

  • Advantages for Optogenetics:

    • Native coupling to G-protein signaling pathways

    • Activation by blue light, which has lower phototoxicity than UV light

    • Faster kinetics compared to many microbial opsins

    • Potential for combining with red-shifted opsins for dual-channel control

  • Potential Applications:

    • Neural Circuit Manipulation: Express in specific neuron populations to enable light-mediated activation

    • Cell Signaling Studies: Use to trigger G-protein cascades with precise temporal control

    • Vision Restoration: Potential for introducing into surviving retinal cells in models of photoreceptor degeneration

  • Technical Considerations:

    • Modify C-terminus to improve membrane trafficking in non-native cell types

    • Consider using zebrafish opn1sw2 due to its evolution in an aqueous environment similar to mammalian tissues

    • Optimize chromophore delivery for in vivo applications

This application builds on the established properties of opn1sw2 as a light-sensitive protein that can couple to intracellular signaling pathways, potentially offering advantages over microbial opsins in certain experimental contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.