Recombinant Danio rerio Peroxisomal membrane protein PEX16 (pex16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
pex16; zgc:112248; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
pex16
Target Protein Sequence
MEKLTRVFERYQEYVRTSPAAASHLESTVRALSYLIAGRFSDSHEISELVYSASNLLVLL NDGILRKNLSRTLPMSISQQKLLTWLSVLEYVEVFVEMAAAKMWGDAGRWLVIVLIQIAK AVLRCLLLFWYKSGIQTSPPIIPLDRDSQLCSQDNNEEEDDEDSSFVGQRSGRVVRPLGS APSLQSRLWGLPRKKKVSRNQEEELHSSPTPLGLQETIAESLYIARPLLHLASLGICGKR SWKPWILSGLLEITSFSLLSDMKALNRRERAEMRRRAFLLLYYLLRSPFYDRYSETKILF LLRFLADYVPGVGLVARPLMEYLPIWQKIYFYNWG
Uniprot No.

Target Background

Function
Involved in peroxisome biogenesis.
Database Links
Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the function of PEX16 in zebrafish peroxisome biogenesis?

PEX16 in Danio rerio, similar to its human homolog, functions as a critical component in peroxisomal membrane biogenesis. It serves as a receptor for other peroxisomal membrane proteins (PMPs) during the early stages of peroxisome formation at the endoplasmic reticulum (ER) and in mature peroxisomes. Unlike its counterpart in Yarrowia lipolytica, which participates in peroxisomal fission, zebrafish PEX16 is more functionally aligned with the human version, acting as a PMP receptor that facilitates the integration of peroxins such as PEX3 into membranes .

Methodologically, to study this function, researchers typically employ knockdown or knockout approaches using morpholinos or CRISPR-Cas9 gene editing, followed by microscopic analysis of peroxisome formation and distribution using fluorescently tagged peroxisomal markers.

How does zebrafish PEX16 compare structurally and functionally to human PEX16?

Zebrafish PEX16 shares significant structural and functional similarities with human PEX16, making Danio rerio an excellent model for studying peroxisome-related human diseases. Both proteins are integral membrane proteins that likely contain multiple transmembrane domains. The functional conservation is evidenced by their roles in peroxisomal membrane protein import and organelle biogenesis .

The zebrafish peroxisomal proteome inventory confirms that Danio rerio possesses most peroxisomal proteins found in humans, although there are species-specific differences in certain metabolic enzymes. For instance, zebrafish lack some mammalian peroxisomal proteins like BAAT and ZADH2/PTGR3, but contain other unique proteins such as a putative peroxisomal malate synthase (Mlsl) .

What experimental models are available for studying PEX16 function in zebrafish?

Several experimental models have been developed for studying PEX16 function in zebrafish:

  • Morpholino knockdown models: Using antisense morpholinos to temporarily reduce PEX16 expression during embryonic development.

  • CRISPR-Cas9 knockout lines: Permanent genetic disruption of pex16 to study long-term effects.

  • Transgenic reporter lines: Zebrafish expressing fluorescently tagged peroxisomal markers to visualize peroxisome dynamics in vivo.

  • Recombinant protein expression systems: For biochemical studies of protein-protein interactions involving PEX16.

These models can be combined with high-resolution imaging techniques such as confocal microscopy to track peroxisome formation, distribution, and functional parameters in real-time within living embryos .

What expression systems are most effective for producing recombinant Danio rerio PEX16?

Based on current research practices, the following expression systems have proven effective for recombinant Danio rerio PEX16 production:

Expression SystemAdvantagesLimitationsYieldPurification Tags
E. coli (BL21)Cost-effective, rapid growthPotential misfolding of membrane proteinsModerate (2-5 mg/L)His6, GST
Insect cells (Sf9, High Five)Superior folding for membrane proteinsHigher cost, longer production timeHigh (5-10 mg/L)His6, FLAG
Mammalian cells (HEK293)Native-like post-translational modificationsHighest cost, complex media requirementsLow-moderate (1-3 mg/L)His6, Strep-tag II
Cell-free systemsAvoids toxicity issuesLimited scaleLow (0.5-1 mg/L)Various

For functional studies, insect cell or mammalian expression systems are recommended as they provide better protein folding for multi-spanning membrane proteins like PEX16. For structural studies requiring higher yields, E. coli systems optimized for membrane protein expression (such as C41/C43 strains) with subsequent refolding protocols may be considered .

How can I verify the proper folding and functionality of recombinant PEX16?

Verifying proper folding and functionality of recombinant Danio rerio PEX16 requires a multi-faceted approach:

  • Membrane insertion assay: Confirm proper membrane integration using alkaline extraction or protease protection assays.

  • Binding partner interaction studies: Verify interactions with known binding partners (e.g., PEX3) using pull-down assays, surface plasmon resonance, or microscale thermophoresis.

  • Complementation assays: Express recombinant zebrafish PEX16 in PEX16-deficient cell lines (such as human patient fibroblasts or PEX16-knockout cells) and assess restoration of peroxisome formation using immunofluorescence microscopy .

  • Circular dichroism spectroscopy: Evaluate secondary structure content to ensure proper folding.

  • Functional reconstitution: Incorporate purified PEX16 into liposomes and assess its ability to recruit other PMPs.

A properly folded and functional PEX16 should correctly localize to the ER and peroxisomal membranes, interact with appropriate binding partners, and complement peroxisome biogenesis defects in model systems .

What are the optimal conditions for studying PEX16-protein interactions in vitro?

For studying PEX16-protein interactions in vitro, the following conditions have been found optimal:

ParameterRecommended ConditionsNotes
Buffer composition50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.1% (w/v) digitonin or 0.05% DDMMild detergents preserve membrane protein interactions
Temperature25°C for binding studies, 4°C for long-term storageHigher temperatures may destabilize the protein
Reducing agents1 mM DTT or 5 mM β-mercaptoethanolPrevents non-specific disulfide formation
Protease inhibitorsEDTA-free cocktailPrevents degradation during experiments
Glycerol5-10%Enhances protein stability

When studying specific interactions, such as between PEX16 and PEX3, co-immunoprecipitation or proximity-based approaches (FRET, BiFC) have proven most informative. For higher-throughput screening of multiple potential interacting partners, protein microarrays or yeast two-hybrid systems modified for membrane proteins can be employed .

How does PEX16 knockout affect peroxisome formation in zebrafish compared to mammalian models?

Recent research has revealed interesting differences in PEX16 requirement across species. In mammalian models, contrary to the traditional view that PEX16 is absolutely essential for peroxisome formation, PEX16-knockout cells from various mammalian cell lines show a heterogeneous phenotype: some cells contain fewer, enlarged peroxisomes while others lack peroxisomes entirely. This suggests that mammalian cells may be able to form peroxisomes de novo and maintain them without PEX16, albeit less efficiently .

Similar studies in zebrafish would be valuable to determine whether this partial dependence on PEX16 is conserved. Based on the comparative peroxisomal proteome analysis between zebrafish and humans, we would expect similar but potentially not identical phenotypes in zebrafish PEX16 knockouts .

Methodologically, this could be investigated using CRISPR-Cas9 to generate zebrafish pex16 mutants, followed by thorough characterization of peroxisome number, morphology, and function across different tissues and developmental stages using a combination of electron microscopy, fluorescence microscopy with peroxisomal markers, and biochemical assays for peroxisomal metabolic functions .

What are the key experimental considerations when using PEX16 variants to study peroxisome-related disorders?

When using PEX16 variants to study peroxisome-related disorders, researchers should consider:

  • Variant selection and classification: Distinguish between variants associated with different disease severities. Research in model organisms suggests that some missense alleles (e.g., PEX2C247R) can be as severe as truncation mutations (e.g., PEX2R119*), while others associated with milder phenotypes (e.g., PEX2E55K) show variable effects depending on the assay .

  • Expression level control: Ensure consistent expression levels across variants to avoid confounding effects from differential protein abundance.

  • Functional redundancy: Consider the possibility of compensatory mechanisms, especially given recent findings that PEX16 may not be absolutely required for peroxisome formation in all contexts .

  • Cell type specificity: Different tissues may show variable sensitivity to PEX16 dysfunction. In zebrafish, this can be studied using tissue-specific promoters driving variant expression.

  • Developmental timing: Peroxisome requirements change during development, necessitating temporal analysis of phenotypes.

The experimental approach should include complementation assays in PEX16-deficient backgrounds, detailed characterization of peroxisome morphology and function, and assessment of downstream metabolic pathways affected by peroxisomal dysfunction .

How can high-throughput approaches be adapted to screen for compounds affecting zebrafish PEX16 function?

High-throughput screening approaches for compounds affecting zebrafish PEX16 function can be implemented using these methodological strategies:

  • Zebrafish embryo-based screening:

    • Generate transgenic zebrafish expressing fluorescent peroxisomal markers

    • Develop automated image analysis pipelines to quantify peroxisome number, size, and distribution

    • Screen compound libraries in multi-well format, treating embryos from 24-72 hours post-fertilization

    • Use automated microscopy to capture images across multiple embryos and tissue types

  • Cell-based reporter systems:

    • Develop zebrafish cell lines with fluorescent reporters for peroxisome formation

    • Implement PEX16-dependent split reporter systems (e.g., split GFP where complementation depends on proper PEX16 function)

    • Use flow cytometry or high-content imaging for rapid phenotypic assessment

  • Biochemical screening approaches:

    • Design assays measuring PEX16 interactions with key binding partners (e.g., PEX3)

    • Develop FRET-based biosensors to detect protein-protein interactions in real-time

    • Implement assays for downstream peroxisomal metabolic functions

  • Data analysis and validation:

    • Apply machine learning algorithms to identify subtle phenotypic changes

    • Validate hits with secondary assays focusing on specific aspects of PEX16 function

    • Confirm mechanism of action through targeted biochemical and cellular assays

How can I address the challenge of PEX16 degradation during recombinant expression and purification?

PEX16, being a multi-spanning membrane protein, presents several challenges during recombinant expression and purification. To address degradation issues:

  • Optimize expression conditions:

    • Reduce expression temperature (16-20°C)

    • Use weaker promoters to slow expression rate

    • Add chemical chaperones (e.g., 4% glycerol, 1 M sorbitol) to expression media

  • Improve purification strategy:

    • Include protease inhibitor cocktail at all stages

    • Maintain constant low temperature (4°C)

    • Use rapid purification protocols to minimize exposure time

    • Consider on-column folding approaches

  • Stabilize the protein:

    • Test multiple detergents (DDM, LMNG, GDN) for optimal extraction and stability

    • Add lipids (POPC, POPE) during purification to stabilize the native structure

    • Screen stabilizing additives (glycerol, arginine, specific lipids from zebrafish)

  • Engineering approaches:

    • Remove flexible regions prone to degradation

    • Consider fusion partners that enhance stability (e.g., T4 lysozyme)

    • Create truncated constructs focusing on functional domains

A systematic approach testing these strategies, monitored by SDS-PAGE and Western blotting with anti-PEX16 antibodies, will help identify optimal conditions for your specific construct and expression system .

What are the most reliable methods to distinguish between direct and indirect effects in PEX16 functional studies?

Distinguishing between direct and indirect effects in PEX16 functional studies requires rigorous experimental design:

  • Acute vs. chronic manipulation:

    • Use inducible systems (e.g., Tet-On/Off) to control timing of PEX16 disruption

    • Compare rapid depletion methods (auxin-inducible degron) with genetic knockouts

    • Monitor temporal progression of phenotypes to separate primary from secondary effects

  • Rescue experiments:

    • Perform complementation with wild-type PEX16 to confirm phenotype specificity

    • Use structure-guided mutants affecting specific interactions to dissect functions

    • Implement domain swapping with orthologs (human, yeast) to identify functional regions

  • Direct biochemical validation:

    • Confirm protein-protein interactions using in vitro reconstitution with purified components

    • Employ proximity labeling approaches (BioID, APEX) to identify direct interactors in vivo

    • Use cross-linking mass spectrometry to map interaction surfaces

  • Bypass experiments:

    • Test whether artificial targeting of PEX16 partners to peroxisomes bypasses PEX16 requirement

    • Evaluate whether constitutive activation of downstream pathways rescues PEX16 deficiency

These approaches collectively provide strong evidence for distinguishing direct functions of PEX16 from secondary consequences of peroxisome dysfunction .

How can contradictory data regarding PEX16 essentiality be reconciled in experimental design?

Recent research has revealed contradictions regarding PEX16 essentiality in peroxisome formation. To reconcile these contradictions in experimental design:

  • Consider cellular context:

    • Recent studies show that PEX16-knockout mammalian cells exhibit heterogeneous phenotypes - some cells have fewer, enlarged peroxisomes while others lack peroxisomes entirely

    • Different cell types may have varying dependencies on PEX16, possibly due to different expression levels of compensatory factors

  • Examine technical variables:

    • Different knockout strategies (complete vs. hypomorphic alleles) may yield different results

    • Cell culture conditions can influence peroxisome formation pathways

    • Detection sensitivity matters - sensitive methods may detect peroxisomal remnants missed by other approaches

  • Evaluate temporal dynamics:

    • PEX16 may accelerate peroxisome formation without being absolutely required

    • Long-term adaptation may compensate for acute PEX16 loss

    • Monitor peroxisome formation over extended time periods (days to weeks)

  • Design definitive experiments:

    • Generate true null alleles and confirm absence of truncated proteins

    • Implement live imaging to track peroxisome formation dynamics in real-time

    • Compare de novo formation vs. growth and division pathways

    • Study both embryonic development and adult physiology in model organisms

  • Control for dominant-negative effects:

    • Some patient-derived PEX16 mutations may act in a dominant-negative manner, inhibiting de novo peroxisome formation more severely than complete loss of the protein

This comprehensive approach will help clarify the precise role of PEX16 across different species and cellular contexts .

What emerging technologies could advance our understanding of PEX16 dynamics in zebrafish models?

Several cutting-edge technologies show promise for elucidating PEX16 dynamics in zebrafish:

  • Advanced imaging approaches:

    • Super-resolution microscopy (PALM/STORM, STED) to visualize PEX16 distribution with nanometer precision

    • Lattice light-sheet microscopy for high-speed 3D imaging of peroxisome formation in living embryos

    • Correlative light and electron microscopy (CLEM) to connect fluorescence observations with ultrastructural details

  • Genome engineering and screening:

    • CRISPR activation/interference (CRISPRa/CRISPRi) for tunable control of PEX16 expression

    • Base editing and prime editing for precise introduction of disease-relevant mutations

    • Whole-organism CRISPR screens to identify genetic modifiers of PEX16 function

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell-type-specific responses to PEX16 disruption

    • Single-cell proteomics to characterize changes in protein expression and localization

    • Spatial transcriptomics to map peroxisome-related gene expression across tissues

  • Protein dynamics and interaction mapping:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure PEX16 mobility in membranes

    • Optogenetic tools to control PEX16 interactions with temporal precision

    • Proximity labeling approaches (TurboID, APEX2) to map the PEX16 interaction network in vivo

These technologies could reveal new insights into how PEX16 functions in different tissues and developmental stages in zebrafish, potentially identifying novel therapeutic targets for peroxisomal disorders .

How might comparative studies between zebrafish and human PEX16 inform therapeutic strategies for peroxisomal disorders?

Comparative studies between zebrafish and human PEX16 could inform therapeutic strategies through:

  • Structure-function relationships:

    • Identifying conserved domains essential for function versus species-specific regions

    • Mapping disease-causing mutations to functional domains

    • Developing targeted approaches to rescue specific functional defects

  • Drug screening platforms:

    • Zebrafish models expressing human PEX16 variants can provide in vivo screening platforms

    • Phenotypic rescue assays allow identification of compounds that restore peroxisome function

    • Comparison of drug efficacy between zebrafish and human cell models aids in translation

  • Compensatory pathway discovery:

    • Identifying pathways that compensate for PEX16 dysfunction in zebrafish might reveal therapeutic targets

    • Recent findings suggest mammalian cells can form peroxisomes without PEX16, albeit inefficiently

    • Understanding the molecular basis of this compensation could inform therapeutic approaches

  • Precision medicine applications:

    • Determining variant-specific impacts through parallel testing in zebrafish and human cells

    • Evidence suggests different PEX16 variants have distinct severity profiles and may require different interventions

    • Patient-specific zebrafish models could predict treatment response

  • Developmental considerations:

    • Zebrafish models allow assessment of interventions at different developmental stages

    • Identifying critical windows for therapeutic intervention

    • Evaluation of long-term outcomes following early treatment

This comparative approach leverages the experimental advantages of zebrafish while maintaining focus on human disease relevance .

What are the potential applications of recombinant Danio rerio PEX16 in structural biology studies?

Recombinant Danio rerio PEX16 offers several promising applications for structural biology:

  • Membrane protein structure determination:

    • Zebrafish PEX16 may have properties favorable for crystallization or cryo-EM studies

    • Comparative analysis with human PEX16 could reveal conserved structural features

    • Multiple transmembrane domains make PEX16 an interesting target for membrane protein structural biology

  • Interaction interface mapping:

    • Determining the structural basis of PEX16 interactions with PEX3 and other partners

    • Cross-linking mass spectrometry to identify interaction surfaces

    • Co-crystallization with binding partners or fragments thereof

  • Conformational dynamics studies:

    • Single-molecule FRET to detect conformational changes upon binding partners

    • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

    • Nuclear magnetic resonance (NMR) studies of isolated domains

  • Structure-guided drug design:

    • High-resolution structures could identify potential binding pockets

    • Fragment-based screening against purified protein

    • Structure-based virtual screening for compounds that stabilize functional conformations

  • Methodological advances:

    • Lipid nanodiscs or styrene maleic acid lipid particles (SMALPs) for native-like membrane environment

    • Fusion protein approaches to stabilize flexible regions

    • Comparative analysis across species to identify stable constructs

These structural biology applications could significantly advance our understanding of peroxisome biogenesis at the molecular level and facilitate the development of targeted therapeutics for peroxisomal disorders .

What are the key factors to consider when designing a comprehensive research project on Danio rerio PEX16?

When designing a comprehensive research project on Danio rerio PEX16, consider these key factors:

  • Evolutionary context:

    • Include comparative analyses with human and other model organism PEX16 proteins

    • Consider the zebrafish-specific peroxisomal proteome differences identified in systematic studies

    • Evaluate both conserved and divergent functions

  • Multi-level approach:

    • Combine molecular, cellular, and organismal investigations

    • Link biochemical mechanisms to physiological outcomes

    • Integrate structural insights with functional studies

  • Technical considerations:

    • Account for the current understanding that PEX16 may not be absolutely essential for peroxisome formation

    • Design clean genetic models with appropriate controls

    • Include rescue experiments to validate specificity

  • Developmental perspective:

    • Leverage zebrafish transparency for in vivo imaging across development

    • Consider tissue-specific roles and requirements

    • Examine both embryonic and adult phenotypes

  • Translational potential:

    • Focus on aspects relevant to human peroxisomal disorders

    • Include disease-relevant variants for comparative analysis

    • Develop assays suitable for therapeutic screening

A successful project will integrate these considerations while maintaining experimental rigor and embracing new methodological advances in the field .

How should researchers interpret and troubleshoot variable results in PEX16 functional assays?

When facing variable results in PEX16 functional assays, researchers should:

  • Systematically evaluate technical variables:

    • Protein expression levels - use quantitative Western blotting to ensure consistent expression

    • Cell culture conditions - standardize confluence, passage number, and media composition

    • Detection sensitivity - employ multiple markers and methods to assess peroxisome formation

  • Consider biological heterogeneity:

    • Recent research shows that PEX16-knockout cells exhibit heterogeneous phenotypes

    • Single-cell analysis may reveal subpopulations with different responses

    • Temporal dynamics can influence outcomes - extend observation periods

  • Implement rigorous controls:

    • Include positive controls (known functional constructs) and negative controls (known non-functional variants)

    • Use internal controls within the same sample where possible

    • Perform parallel experiments in different cell types or model systems

  • Address potential confounding factors:

    • Test for dominant-negative effects of mutant proteins

    • Consider compensation by parallel pathways

    • Evaluate interactions with other peroxins that might influence outcomes

  • Refine experimental design:

    • Move from population averages to single-cell/single-organelle analysis

    • Implement time-course studies to capture dynamic processes

    • Combine complementary methodologies (biochemical, microscopy, functional)

This systematic troubleshooting approach will help distinguish meaningful biological variability from technical artifacts and lead to more reproducible and interpretable results .

What collaborative approaches would maximize the impact of research on zebrafish PEX16?

To maximize research impact on zebrafish PEX16, consider these collaborative approaches:

  • Interdisciplinary team formation:

    • Combine expertise in:

      • Developmental biology (zebrafish specialists)

      • Biochemistry and structural biology (protein scientists)

      • Cell biology (peroxisome experts)

      • Clinical research (peroxisomal disorder specialists)

      • Computational biology (for modeling and data analysis)

  • Resource sharing and standardization:

    • Establish repositories for validated reagents (antibodies, constructs, zebrafish lines)

    • Develop standardized protocols for key assays

    • Create open-access databases for phenotypic and functional data

  • Technology integration:

    • Partner with imaging specialists for advanced microscopy approaches

    • Collaborate with structural biologists for protein structure determination

    • Engage computational scientists for systems-level analysis

  • Translational connections:

    • Form consortia including basic scientists and clinicians

    • Incorporate patient-derived cells and mutations

    • Develop parallel human and zebrafish experimental systems

  • Cross-species comparative approach:

    • Coordinate studies across multiple model organisms (zebrafish, mice, flies)

    • Systematically compare findings to identify conserved mechanisms

    • Jointly develop tools applicable across species

These collaborative approaches would accelerate discovery by combining diverse expertise and resources, ultimately leading to a more comprehensive understanding of PEX16 biology and potentially new therapeutic strategies for peroxisomal disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.