Recombinant Danio rerio Phosphatidylinositide phosphatase SAC1-A (sacm1la)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
sacm1lb; zgc:158642; Phosphatidylinositol-3-phosphatase SAC1-B; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
sacm1lb
Target Protein Sequence
MASTYNSFNLHTTAEKFYIEACDDGVGDVLAIDRVSTEKTLTVRKDVPPSAVTRPICGIM GTIRLVAGVYLIVITKKKKVGDLLGHAVWKASDFDIISYKKTVLHLTDNQMQDNKVFLSM LNSVLNTDGFYFATDYDLTHTLQRLSNTSPEFQEMTLLERADQRFVWNGHLLREFMAQPE LHRFVFPVIHGFIAMRSCCINGKIFDWNLISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIIQYNGAKASFIQTRGSIPFYWSQRPNLKYKPKPQISKSINHLDGFQRHFDSQIIIYGK QVILNLVNQKGSEKPLEQAFAKMVGSLGNGMIKYIAFDFHKECSRMRWHRLQILVDTVAE LQDEFGYFLVDSDGSVQMQQDGTFRSNCMDCLDRTNVVQSLLARRSLQSQLERMAVLHVG QRIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQWGLLMDGWNSMIRY YKNNFSDGFRQDSIDLFLGNYAVEEADMNTPLHEPKDWKFLTLPIIMVVAFSMCIICLLM AGDTWTETLAYVLFWGSASVVTGGVILFNGRDFVDAPRLVQKEKMD
Uniprot No.

Target Background

Function
Phosphoinositide phosphatase that catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylinositide phosphatase SAC1-A (sacm1la) and what is its significance in zebrafish?

Phosphatidylinositide phosphatase SAC1-A (sacm1la) is an enzyme in zebrafish (Danio rerio) that belongs to the SAC1 family of phosphatidylinositol phosphatases. This protein plays a critical role in phosphoinositide metabolism, which is fundamental to lipid signaling, membrane identity, and trafficking processes . In zebrafish, sacm1la is particularly important for regulating phosphatidylinositol-4-phosphate levels, which has implications for autophagosomal function and cellular homeostasis .

The significance of studying sacm1la extends beyond basic science; as a model organism, zebrafish provides valuable insights into conserved phosphoinositide signaling pathways that are relevant to human disease. Research focusing on SAC1 in zebrafish has demonstrated its evolutionarily conserved role in maintaining phosphoinositide balance across species.

How is recombinant sacm1la protein typically expressed and what are the key considerations for protein yield?

Recombinant sacm1la is typically expressed using in vitro E. coli expression systems, as documented for the commercially available form . The recombinant protein is often produced with an N-terminal tag, such as a 10xHis-tag, to facilitate purification and detection .

Key considerations for optimizing protein yield include:

  • Expression vector selection: Vectors with strong promoters (T7, tac) are often preferred

  • Strain selection: BL21(DE3) and derivatives are commonly used for recombinant protein expression

  • Induction conditions: Temperature, inducer concentration, and duration significantly impact yield

  • Solubility enhancement: Co-expression with chaperones or fusion with solubility tags can improve yield

  • Cell lysis methods: Optimizing lysis buffer composition is critical for extracting membrane-associated phosphatases

For sacm1la specifically, given its function as a phosphatidylinositide phosphatase, maintaining proper folding during expression is crucial for preserving enzymatic activity. Temperature reduction during induction (to 16-20°C) is often employed for improved folding of complex enzymes.

What storage conditions maintain optimal stability and activity of recombinant sacm1la?

Based on established protocols for similar recombinant proteins, sacm1la should be stored under the following conditions to maintain stability and activity:

  • For lyophilized protein: -20°C/-80°C with a typical shelf life of 12 months

  • For liquid formulations: -20°C/-80°C with a shelf life of approximately 6 months

  • Buffer composition: Tris/PBS-based buffer, pH 8.0, supplemented with 6% Trehalose as a cryoprotectant

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles, which can significantly reduce enzymatic activity

To validate protein stability over time, activity assays should be performed periodically using standard phosphatidylinositide substrates.

What methodological approaches are most effective for measuring sacm1la phosphatase activity?

Measuring the phosphatase activity of sacm1la requires specific assay conditions that reflect its natural substrate preferences and biochemical properties. The following methodological approaches are recommended:

  • Malachite Green Phosphate Assay: This colorimetric assay detects inorganic phosphate released from phosphoinositide substrates and is suitable for high-throughput screening.

  • Radiolabeled Substrate Assay: Using 32P-labeled phosphoinositides provides high sensitivity but requires appropriate radiation safety measures.

  • Fluorescence-based Assays: Employing fluorescent phosphoinositide analogs allows real-time monitoring of enzymatic activity.

The assay buffer composition should be optimized based on what is known about SAC1 family phosphatases:

ComponentOptimal ConcentrationRationale
HEPES or Tris50 mM, pH 7.4-7.6Maintains optimal pH for phosphatase activity
NaCl100-150 mMProvides physiological ionic strength
MgCl₂5-10 mMCofactor for phosphatase activity
DTT1-2 mMMaintains reduced state of critical cysteine residues
BSA0.1-0.5 mg/mlPrevents non-specific binding and increases stability

For the substrate, phosphatidylinositol-4-phosphate (PI4P) would be the primary choice given the known preference of SAC1 phosphatases for this lipid .

How can I validate the specificity of sacm1la against different phosphoinositide substrates?

Validating the substrate specificity of sacm1la requires a systematic approach:

  • Substrate Panel Testing: Assay activity against all seven phosphoinositide species (PI3P, PI4P, PI5P, PI(3,4)P₂, PI(3,5)P₂, PI(4,5)P₂, PI(3,4,5)P₃) using identical assay conditions.

  • Kinetic Parameter Determination: Calculate Km and Vmax values for each substrate to quantitatively assess preference.

  • Competitive Substrate Assays: Measure activity in the presence of multiple substrates to determine preferential hydrolysis.

  • Structure-Function Analysis: Use site-directed mutagenesis of the catalytic domain to alter specific residues and correlate with changes in substrate preference.

  • Inhibitor Profiling: Test the effect of known phosphoinositide phosphatase inhibitors on sacm1la activity.

Similar to bicarbonate-responsive enzymes described in the literature, specific small-molecule inhibitors can be used to validate enzyme function . The use of carefully selected controls is essential for distinguishing specific enzymatic activity from background phosphate release.

What experimental design principles should be followed when studying sacm1la in cellular systems?

When designing experiments to study sacm1la in cellular systems, researchers should adhere to these fundamental principles:

  • Controlled Variation: Systematically manipulate variables while controlling others to isolate causal effects of sacm1la activity . This includes using:

    • Wild-type controls alongside sacm1la manipulations

    • Multiple cell lines or primary cultures to ensure robustness of findings

    • Dose-dependent experiments for overexpression or inhibition studies

  • Appropriate Randomization: To minimize selection bias, samples should be randomly assigned to experimental conditions . This is particularly important when:

    • Selecting cells for imaging analysis

    • Assigning animals to different treatment groups in zebrafish studies

    • Processing samples for biochemical assays

  • Internal Validation Controls: For each experiment, include the following controls:

    • Enzyme-dead mutants (catalytic domain mutations)

    • Positive controls (known phosphatidylinositide phosphatases)

    • Vehicle controls for inhibitor studies

  • Confounding Variable Management: Account for variables that might influence experimental outcomes, such as:

    • Cell density and passage number

    • Temperature fluctuations during live imaging

    • Developmental stage of zebrafish embryos

These principles help maximize internal validity and support reliable causal inferences about sacm1la function .

How does sacm1la interact with the autophagy pathway in zebrafish models?

Research indicates that SAC1 family phosphatases, including sacm1la, play crucial roles in regulating autophagosomal phosphatidylinositol-4-phosphate (PI4P) levels . In zebrafish models, this interaction can be studied through several methodological approaches:

  • Fluorescent Reporter Systems: Using LC3-GFP fusion proteins to visualize autophagosome formation in zebrafish embryos with manipulated sacm1la levels.

  • Phosphoinositide Probes: Employing PI4P-specific fluorescent probes (e.g., P4M domain) to monitor PI4P dynamics during autophagy induction.

  • Genetic Approaches: Utilizing CRISPR-Cas9 gene editing to create sacm1la mutants or conditional knockouts in zebrafish.

  • Pharmacological Intervention: Combining sacm1la manipulation with autophagy inducers (rapamycin) or inhibitors (bafilomycin A1) to dissect pathway interactions.

The methodology for these experiments should include careful documentation of:

  • Developmental timing for interventions

  • Quantitative image analysis parameters

  • Biochemical validation of autophagy markers (LC3-I to LC3-II conversion)

  • Controls for non-specific effects of genetic manipulations

Analysis should focus on both basal autophagy and stress-induced autophagy to fully characterize the role of sacm1la in these processes.

What are the best methodological approaches for studying sacm1la in zebrafish development?

To effectively study sacm1la's role in zebrafish development, researchers should employ these methodological approaches:

  • Temporal Expression Profiling:

    • RT-qPCR analysis of sacm1la expression at different developmental stages

    • In situ hybridization to visualize spatial expression patterns

    • RNA-seq analysis to identify co-regulated genes

  • Loss-of-Function Studies:

    • Morpholino antisense oligonucleotides for transient knockdown

    • CRISPR-Cas9 gene editing for stable mutant lines

    • Small molecule inhibitors of phosphatidylinositide phosphatases

  • Gain-of-Function Studies:

    • mRNA microinjection for overexpression

    • Transgenic lines with tissue-specific or inducible expression

    • Rescue experiments in mutant backgrounds

  • Phenotypic Analysis:

    • Morphological assessments at key developmental timepoints

    • Organ-specific functional assays

    • Behavioral studies for neurological phenotypes

When documenting developmental phenotypes, it's crucial to establish:

  • Clear staging criteria

  • Quantitative scoring systems for phenotypic severity

  • Statistical approaches for handling phenotypic variability

  • Methods to distinguish specific from non-specific effects

The analysis should focus on developmental processes known to be regulated by phosphoinositide signaling, such as cell migration, tissue patterning, and organogenesis.

How can the bicarbonate-sensing properties of SAC family proteins inform research on sacm1la?

The bicarbonate-sensing properties observed in soluble adenylyl cyclase (sAC) family proteins provide valuable insights for sacm1la research. Although sacm1la is a phosphatidylinositide phosphatase rather than an adenylyl cyclase, both enzyme families are involved in cellular signaling and can be studied using similar methodological principles .

Key approaches derived from bicarbonate-sensing studies include:

  • Recombinant Protein Characterization:

    • Testing recombinant sacm1la activity under varying bicarbonate concentrations

    • Examining the effects of pH changes on enzyme activity

    • Using specific inhibitors to validate biochemical properties

  • Structure-Function Analysis:

    • Generating N-terminal His-tagged recombinant constructs similar to those used in sAC studies

    • Creating truncated constructs containing only catalytic domains

    • Performing site-directed mutagenesis of potential regulatory sites

  • Cellular Assays:

    • Monitoring intracellular phosphoinositide levels in response to CO₂/HCO₃⁻ changes

    • Tracking subcellular localization under different bicarbonate conditions

    • Examining potential cross-talk between phosphoinositide and cAMP signaling pathways

Drawing from research on bicarbonate-sensing enzymes, it's important to:

  • Control CO₂/HCO₃⁻ concentrations precisely in experimental setups

  • Use multiple methodologies to confirm findings

  • Consider the physiological relevance of in vitro observations

These approaches may reveal novel regulatory mechanisms for sacm1la that parallel those found in other signaling enzymes.

What are the most appropriate statistical methods for analyzing sacm1la activity data?

When analyzing data related to sacm1la activity, researchers should employ statistical methods appropriate for biochemical and molecular biology experiments:

  • For Enzyme Kinetics:

    • Non-linear regression analysis for Michaelis-Menten kinetics

    • Lineweaver-Burk or Eadie-Hofstee plots for visualizing kinetic parameters

    • Statistical comparison of Km and Vmax values between conditions

  • For Cell-Based Assays:

    • Two-way ANOVA for experiments with multiple variables (e.g., time and treatment)

    • Repeated measures approaches for time-course experiments

    • Bonferroni's or Tukey's post-tests for multiple comparisons

  • For In Vivo Studies:

    • Power analysis to determine appropriate sample sizes

    • Non-parametric tests for developmental phenotype data that may not be normally distributed

    • Survival analysis methods for developmental progression studies

Statistical considerations should include:

  • Testing for normal distribution before applying parametric tests

  • Using appropriate methods for dealing with outliers

  • Accounting for multiple comparisons when analyzing large datasets

  • Reporting effect sizes alongside p-values for better interpretation of biological significance

How should contradictory findings in sacm1la research be approached and analyzed?

When faced with contradictory findings in sacm1la research, a systematic approach to analysis is essential:

The approach should be guided by principles of causal inference and validity in experimental design , recognizing that apparent contradictions may reveal complex regulatory mechanisms or context-dependent functions of sacm1la.

What are promising methodological innovations for studying the structural biology of sacm1la?

Advanced structural biology approaches offer promising avenues for sacm1la research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of membrane-associated conformations without crystallization

    • Allows study of sacm1la in complex with binding partners or substrates

    • Provides insights into conformational changes during catalytic cycles

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Identifies dynamic regions and conformational changes upon substrate binding

    • Requires less protein than crystallography

    • Can detect subtle changes in protein structure upon inhibitor binding

  • Integrative Structural Biology Approaches:

    • Combining X-ray crystallography, NMR, SAXS, and computational modeling

    • Using crosslinking mass spectrometry to identify protein-protein interaction interfaces

    • Molecular dynamics simulations to understand membrane interactions

  • In-Cell Structural Studies:

    • FRET sensors to monitor conformational changes in living cells

    • Nanobody-based probes to detect specific conformational states

    • Cellular thermal shift assays (CETSA) to assess target engagement in vivo

These approaches require careful consideration of protein purification strategies, ensuring that recombinant sacm1la retains its native structure and function. N-terminal tagging strategies, similar to those used for His-tagged constructs in previous studies , can facilitate purification while minimizing interference with catalytic activity.

How can multi-omics approaches advance our understanding of sacm1la function in zebrafish?

Multi-omics approaches can provide comprehensive insights into sacm1la function:

  • Phosphoproteomics:

    • Identify downstream signaling pathways affected by sacm1la activity

    • Quantify changes in phosphorylation states upon sacm1la manipulation

    • Reveal potential feedback mechanisms and regulatory networks

  • Lipidomics:

    • Profile global changes in phosphoinositide species and other lipids

    • Identify unexpected lipid substrates or products

    • Map membrane compositional changes during development

  • Transcriptomics:

    • Characterize gene expression changes in sacm1la mutants or knockdowns

    • Identify compensatory mechanisms and secondary effects

    • Discover co-regulated gene networks

  • Metabolomics:

    • Assess metabolic consequences of altered phosphoinositide signaling

    • Identify potential biomarkers of sacm1la dysfunction

    • Connect lipid signaling to broader metabolic networks

Integrating these datasets requires sophisticated bioinformatics approaches:

  • Pathway enrichment analysis

  • Network modeling of multi-omics data

  • Machine learning for pattern recognition

  • Temporal modeling of developmental processes

The experimental design should include appropriate controls and time points to capture both immediate and delayed consequences of sacm1la perturbation, following principles of controlled variation to maximize internal validity .

What methodological considerations are important when developing small molecule modulators of sacm1la activity?

The development of small molecule modulators for sacm1la requires methodological rigor across multiple stages:

  • Assay Development for High-Throughput Screening:

    • Optimization for signal-to-noise ratio and Z' factor

    • Miniaturization to 384- or 1536-well format

    • Development of counter-screens to eliminate false positives

    • Validation with known phosphatase inhibitors or activators

  • Compound Selection and Screening:

    • Biased approaches based on known phosphatase inhibitor scaffolds

    • Fragment-based screening for novel chemical scaffolds

    • In silico screening using structural models of sacm1la

    • Diversity-oriented synthesis to explore chemical space

  • Structure-Activity Relationship (SAR) Studies:

    • Systematic modification of hit compounds

    • Assessment of specificity against other phosphatidylinositide phosphatases

    • Optimization for physicochemical properties

    • Medicinal chemistry approaches to improve potency and selectivity

  • Validation Methodologies:

    • Target engagement assays in cellular systems

    • Phenotypic validation in zebrafish models

    • ADME and toxicity profiling

    • Mechanistic studies to confirm mode of action

Drawing from the experience with sAC inhibitors like KH7 and 4-catechol estrogen (4CE) , researchers should establish clear IC₅₀ values and compare these across different experimental conditions. Similar to the approach used for dfsAC, where inhibitors were tested with IC₅₀s of 9.6 and 46.9 μM for KH7 and 4CE respectively , establishing dose-response relationships is crucial for characterizing sacm1la modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.