Recombinant Danio rerio Phosphatidylinositide phosphatase SAC1-B (sacm1lb)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio Phosphatidylinositide Phosphatase SAC1-B (sacm1lb)

The Recombinant Danio rerio Phosphatidylinositide Phosphatase SAC1-B (sacm1lb) is a full-length recombinant protein derived from zebrafish (Danio rerio), expressed in E. coli with an N-terminal His-tag for purification . It corresponds to the gene sacm1la (UniProt ID: A4VCH0), encoding a phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase and phosphatidylinositol-4-phosphate phosphatase . This enzyme is critical for lipid metabolism and cellular processes such as autophagy, membrane trafficking, and organelle dynamics .

Research Applications and Pathways

4.1 Role in Autophagy
SAC1-B restricts PI4P at the Golgi, enabling autophagosomes to fuse with lysosomes. Deficiency in SAC1 activity disrupts this process, leading to autophagosome accumulation .

4.2 Microtubule Organization and Cell Morphology
In Drosophila, SAC1 homologs regulate microtubule stability and epithelial cell patterning. Elevated PI4P in SAC1 mutants correlates with microtubule disorganization and defective trafficking of adhesion molecules (e.g., Roughest) .

4.3 Liver Disease and Regeneration Models
Zebrafish models with SAC1-B dysfunction may inform studies on liver pathologies, particularly biliary defects linked to PI4P dysregulation .

4.4 Toxicological Interactions
SACM1L expression (orthologous to SAC1-B) is modulated by environmental toxins (e.g., bisphenol A, arsenic), suggesting utility in studying xenobiotic-induced lipid metabolic disorders .

Pathways and Interactions

PathwayKey ComponentsSAC1-B Function
PI MetabolismPI4K, PIP5K, PI3K, PTENDephosphorylates PI4P and PI(3,5)P₂
AutophagyAtg9, SNARE proteins, HOPS complexEnsures autophagosome-lysosome fusion
Lipid SynthesisStt4, Pik1 (PI4 kinases)Antagonizes Stt4-generated PI4P
Microtubule DynamicsExocyst complex, Sec8Promotes vesicle trafficking via PI4P control

Comparative Analysis with Homologs

FeatureSAC1-B (Zebrafish)Human SACM1LYeast Sac1p
Expression HostE. coliMammalian cellsS. cerevisiae
TagHis-tagNone/Flag-tagNative
PI4P Phosphatase ActivityHighHighHigh
Subcellular LocalizationGolgi/ERGolgi/ER-plasma membrane contact sitesER

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this at the time of order; we will prioritize fulfilling your request.
Synonyms
sacm1la; si:ch211-222e23.8; Phosphatidylinositol-3-phosphatase SAC1-A; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
sacm1la
Target Protein Sequence
MANAYERFNLHSTPEKFYIEACDDGADDVLVIDRVSTEMTLAGIKDIPPSGITRPICGVM GTVRLVAGMYLIVITRKRKVGDLFGHTVWKAVEFDVISYKKTILHLTDIQMQDNKTFLTM INNVLNTDGFYFCTDYDLTHTQQRLSNTSPDFQEMSLLERADQRFMWNGNLLREIIAQPE LHKFAFPVIHGFIVMKPCCINGKVFEWIIISRRSCFRAGVRYYVRGIDSEGHAANFVETE QIVQFNNARASFVQTRGSIPFFWSQRPNLKYKPKPLISKDTNHMDGLRRHFESQVLIYGK QVILNLVNQKGSELPLEQAFAKMVSSMENGFIKYIAFDFHKECSKMRWHRLQILVDAVSD MQEEFGYFMVSSDGKVLSEQSGTFRSNCMDCLDRTNVIQSLLARRSLQSQLQRMGVLHVG QKIEEQADFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHWGLVMDGWNSMIRY YKNNFSDGFRQDSIDLFLGNYSVDETDSLTPLHVKKDWKFLLLPVIMVVAFSMCIICLLM AGDTWTETLAYVLFWGMASALTAAVIVVNGREFVDAPKLVQKEKMD
Uniprot No.

Target Background

Function
Phosphoinositide phosphatase catalyzing the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylinositide phosphatase SAC1-B (sacm1lb) and what are its key characteristics?

Phosphatidylinositide phosphatase SAC1-B (sacm1lb) is a phosphatidylinositol phosphatase enzyme expressed in Danio rerio (zebrafish). It belongs to the SAC phosphatase family and is alternatively known as Suppressor of actin mutations 1-like protein B. The protein has an enzyme classification of EC 3.1.3.- and is encoded by the sacm1lb gene (also known by the ORF name si:ch211-222e23.8). The full-length protein consists of 586 amino acids and contains domains characteristic of phosphoinositide phosphatases that regulate membrane phospholipid composition .

The protein functions primarily in dephosphorylating phosphatidylinositol phosphates, which are critical lipid second messengers involved in various cellular processes including membrane trafficking, cytoskeletal organization, and cell signaling pathways. In its recombinant form, the protein is typically produced with various tags to facilitate purification and experimental applications .

How does recombinant sacm1lb differ from its native form in zebrafish?

Recombinant sacm1lb differs from its native form in several important ways:

  • Expression system: The recombinant protein is produced in heterologous expression systems such as E. coli, yeast, baculovirus, or mammalian cells, whereas the native protein is expressed endogenously in zebrafish tissues .

  • Protein tags: Recombinant versions typically contain additional amino acid sequences (tags) that are not present in the native protein. These may include Avi-tags for biotinylation or other affinity tags determined during the manufacturing process to facilitate purification and detection .

  • Post-translational modifications: Depending on the expression system used, recombinant sacm1lb may have different post-translational modifications compared to the native protein. For instance, proteins expressed in E. coli lack many eukaryotic post-translational modifications, while those expressed in mammalian cells more closely resemble the native form .

  • Protein folding: The three-dimensional structure of recombinant proteins may sometimes differ slightly from native proteins due to differences in the cellular environment during protein synthesis and folding .

  • Functional activity: While recombinant proteins aim to preserve the enzymatic activity of the native protein, differences in structure can potentially affect substrate specificity or catalytic efficiency .

What are the optimal storage and handling conditions for recombinant sacm1lb?

Proper storage and handling of recombinant sacm1lb are crucial for maintaining protein stability and enzymatic activity. Based on manufacturer recommendations and standard protein handling protocols, the following guidelines should be implemented:

Storage conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, add glycerol to a final concentration of 50% and store at -20°C/-80°C

  • For short-term use, store working aliquots at 4°C for up to one week

Handling protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Avoid repeated freezing and thawing as this can lead to protein denaturation and loss of activity

Buffer compatibility:

  • The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability

  • When diluting for experiments, maintain pH between 7.0-8.0 for optimal stability

What expression systems are available for producing recombinant sacm1lb and how do they affect protein characteristics?

Multiple expression systems are available for producing recombinant sacm1lb, each with distinct advantages and limitations that can affect experimental outcomes:

Expression SystemProduct Code ExampleAdvantagesLimitationsBest Applications
E. coliCSB-EP375937DIL1- High yield
- Cost-effective
- Rapid production
- Limited post-translational modifications
- Potential improper folding
- Endotoxin concerns
- Structural studies
- Antibody production
- In vitro enzymatic assays
YeastCSB-YP375937DIL1- Some eukaryotic post-translational modifications
- Proper protein folding
- High yield
- Glycosylation patterns differ from vertebrates
- Longer production time than E. coli
- Functional studies requiring some PTMs
- Protein-protein interaction studies
BaculovirusCSB-BP375937DIL1- Insect cell-based
- Advanced eukaryotic modifications
- Proper folding
- More expensive
- Complex production process
- Longer production timeline
- Structural studies requiring PTMs
- Complex protein assemblies
Mammalian cellsCSB-MP375937DIL1- Most native-like modifications
- Proper folding and processing
- Optimal for complex proteins
- Highest cost
- Lower yields
- Most complex production
- In vivo functional studies
- Studies requiring native-like activity

Additionally, specialized modifications such as biotinylation can be achieved through systems like the Avi-tag Biotinylated version (CSB-EP375937DIL1-B), where E. coli biotin ligase (BirA) catalyzes amide linkage between biotin and the specific lysine of the AviTag . This enables highly specific applications like protein immobilization, pull-down assays, and protein-protein interaction studies .

The choice of expression system should be guided by the specific experimental requirements, balancing factors such as required protein yield, budget constraints, and the importance of post-translational modifications for the intended application .

How can researchers optimize the enzymatic activity assay for recombinant sacm1lb?

Optimizing enzymatic activity assays for recombinant sacm1lb requires careful consideration of substrate selection, assay conditions, and detection methods:

Recommended assay protocol:

  • Substrate preparation:

    • Use purified phosphatidylinositol phosphates (PIPs) as substrates

    • Common substrates include PI(4)P, which is likely dephosphorylated by sacm1lb based on its classification

    • Prepare substrate stocks in appropriate solvent (typically chloroform:methanol:water mixture)

  • Reaction buffer optimization:

    • Buffer composition: 50 mM Tris-HCl, pH 7.5, 100 mM NaCl, 2 mM DTT

    • Divalent cations: Include 5 mM MgCl₂ as a cofactor

    • Temperature: Perform assays at 28°C to mimic zebrafish physiological temperature

    • Time course: Monitor activity at multiple time points (5, 15, 30, 60 minutes)

  • Detection methods:

    • Malachite green assay: Measures released inorganic phosphate

    • HPLC-based methods: Separation and quantification of phosphoinositide species

    • Radiolabeled substrates: Using ³²P-labeled phosphoinositides for highest sensitivity

  • Controls and validation:

    • Include heat-inactivated enzyme as negative control

    • Use commercially available phosphatases with known activity as positive controls

    • Perform inhibitor studies (with PI phosphatase inhibitors) to confirm specificity

  • Data analysis:

    • Calculate enzyme kinetic parameters (Km, Vmax) using substrate concentration gradients

    • Normalize activity to protein concentration determined by Bradford or BCA assay

The optimal pH range for sacm1lb activity is likely 6.5-7.5 based on related phosphatases, but this should be empirically determined. Additionally, researchers should evaluate the effects of different detergents and lipid compositions on enzyme activity, as membrane phosphatases often show context-dependent activity profiles .

What are the recommended approaches for studying sacm1lb's role in phosphoinositide metabolism in zebrafish models?

Studying sacm1lb's role in phosphoinositide metabolism in zebrafish models requires a multi-faceted approach combining genetic manipulation, biochemical analysis, and imaging techniques:

Genetic approaches:

  • CRISPR/Cas9 knockout:

    • Design guide RNAs targeting the sacm1lb gene (si:ch211-222e23.8)

    • Generate complete knockout and observe developmental phenotypes

    • Create conditional knockouts using inducible systems to study stage-specific effects

  • Morpholino knockdown:

    • Design morpholinos against sacm1lb mRNA for transient knockdown

    • Useful for rapid preliminary assessment before generating stable mutant lines

    • Important to include proper controls to validate specificity

  • Transgenic overexpression:

    • Generate transgenic lines expressing sacm1lb under tissue-specific promoters

    • Create fluorescently tagged versions (e.g., sacm1lb-GFP) to track localization

    • Develop inducible expression systems to control timing of overexpression

Biochemical analyses:

  • Lipidomic profiling:

    • Extract total lipids from wild-type and sacm1lb-deficient zebrafish tissues

    • Quantify phosphoinositide species using mass spectrometry

    • Compare phosphoinositide profiles across different developmental stages

  • Protein interaction studies:

    • Perform co-immunoprecipitation to identify binding partners

    • Use recombinant biotinylated sacm1lb for pull-down assays

    • Employ proximity labeling approaches (BioID, APEX) to identify proximal proteins

Imaging approaches:

  • Phosphoinositide sensors:

    • Express fluorescent phosphoinositide-binding domains in zebrafish

    • Monitor changes in phosphoinositide distribution upon sacm1lb manipulation

    • Perform live imaging to observe dynamic changes

  • Subcellular localization:

    • Use immunofluorescence with anti-sacm1lb antibodies

    • Co-stain with markers for different cellular compartments

    • Perform super-resolution microscopy for detailed localization

Developmental and physiological assessment:

  • Tissue-specific analysis:

    • Examine effects on different tissues where phosphoinositide signaling is critical

    • Focus on nervous system, muscle, and epithelial tissues

  • Functional assays:

    • Assess membrane trafficking using endocytic and secretory pathway markers

    • Evaluate cytoskeletal organization in sacm1lb-deficient cells

    • Examine calcium signaling as phosphoinositides regulate calcium channels

By combining these approaches, researchers can comprehensively characterize the role of sacm1lb in phosphoinositide metabolism and its physiological implications in zebrafish development and tissue homeostasis .

How does the zebrafish sacm1lb compare to its mammalian orthologs in structure and function?

Understanding the evolutionary conservation and divergence between zebrafish sacm1lb and its mammalian orthologs provides important context for translational research applications:

Structural comparison:

The zebrafish sacm1lb protein exhibits significant structural similarities to mammalian SAC1 phosphatases, particularly in the catalytic domain. Key features of comparison include:

  • Domain organization:

    • Both zebrafish sacm1lb and mammalian SAC1 contain a conserved SAC phosphatase domain

    • The catalytic CX₅R motif crucial for phosphatase activity is preserved

    • Membrane-spanning regions show higher divergence compared to catalytic domains

  • Sequence homology:

    • Zebrafish sacm1lb shares approximately 70-75% amino acid sequence identity with human and mouse SAC1

    • The highest conservation occurs in the catalytic domain regions

    • The 586-amino acid length of zebrafish sacm1lb is comparable to the ~587 amino acids in human SAC1

  • Post-translational modifications:

    • Key regulatory phosphorylation sites are generally conserved

    • Glycosylation patterns may differ between species, potentially affecting stability

Functional comparison:

  • Substrate specificity:

    • Both zebrafish and mammalian SAC1 primarily dephosphorylate PI(4)P

    • The substrate range may show subtle differences in secondary phosphoinositide targets

    • Zebrafish sacm1lb likely maintains the signature PI(4)P phosphatase activity at the ER and Golgi

  • Subcellular localization:

    • Mammalian SAC1 localizes primarily to the ER and Golgi

    • Zebrafish sacm1lb is predicted to share similar localization patterns

    • Trafficking between compartments may be regulated by similar mechanisms

  • Physiological roles:

    • Mammalian SAC1 is essential for embryonic development and ER homeostasis

    • Zebrafish sacm1lb likely plays similar developmental roles but may have species-specific functions

    • Both are involved in regulating membrane trafficking and lipid metabolism

Evolutionary implications:

The presence of two paralogs in zebrafish (sacm1la and sacm1lb) compared to a single SAC1 gene in mammals suggests potential subfunctionalization or neofunctionalization of these genes following the teleost-specific genome duplication. This may allow researchers to dissect specific functions of the protein by studying each paralog independently .

This comparative understanding enables researchers to appropriately extrapolate findings between zebrafish models and mammalian systems while remaining aware of potential species-specific differences.

What experimental controls should be implemented when using recombinant sacm1lb in phosphatase activity assays?

Implementing rigorous controls is essential for ensuring the validity and reproducibility of phosphatase activity assays using recombinant sacm1lb:

Essential experimental controls:

Control TypePurposeImplementation
Negative controlsConfirm signal specificity- Heat-inactivated sacm1lb (95°C for 10 minutes)
- Catalytically inactive mutant (mutation in the CX₅R motif)
- Reaction buffer without enzyme
Positive controlsValidate assay functionality- Commercial phosphoinositide phosphatase with known activity
- Different lot of validated sacm1lb protein
- Non-specific phosphatase (e.g., alkaline phosphatase) at known concentration
Substrate controlsEnsure substrate integrity- Fresh vs. aged substrate comparison
- Substrate blank (no enzyme treatment)
- Alternative substrate preparations
Inhibitor controlsConfirm enzyme specificity- General phosphatase inhibitors (e.g., sodium orthovanadate)
- SAC1-specific inhibitors if available
- Dose-response with inhibitors
Biological validationCorrelate with in vivo function- Compare results with zebrafish tissue extracts
- Parallel analysis with mammalian SAC1 orthologs
- Complementation assays in sacm1lb-deficient systems

Additional quality control measures:

  • Enzyme purity verification:

    • SDS-PAGE analysis to confirm >85% purity as specified by manufacturers

    • Mass spectrometry to verify protein identity

    • Western blot using anti-SAC1 or anti-tag antibodies

  • Enzyme activity validation:

    • Determine optimal enzyme concentration range for linear response

    • Perform time-course experiments to establish reaction kinetics

    • Verify reproducibility across protein batches

  • Buffer optimization:

    • Test multiple buffer compositions to identify optimal conditions

    • Evaluate effects of different detergents on activity

    • Determine pH optimum with overlapping buffer systems

  • Technical replicates:

    • Minimum of triplicate measurements for each experimental condition

    • Independent experimental replicates (different days, protein preparations)

    • Statistical analysis to determine significance of results

  • Normalization strategies:

    • Normalize activity to protein concentration

    • Include internal standard in each assay plate

    • Consider relative activity rather than absolute values when comparing across experiments

What are common challenges in working with recombinant sacm1lb and how can researchers address them?

Researchers frequently encounter several challenges when working with recombinant sacm1lb. Understanding these limitations and implementing appropriate solutions is crucial for successful experimental outcomes:

Challenge 1: Low enzymatic activity

Potential causes:

  • Protein denaturation during shipping or handling

  • Improper reconstitution procedure

  • Buffer incompatibility

  • Inhibitory contaminants

Solutions:

  • Reconstitute protein strictly according to manufacturer guidelines

  • Test multiple buffer conditions to identify optimal activity environment

  • Add reducing agents (1-2 mM DTT) to prevent oxidation of catalytic cysteine residues

  • Evaluate activity immediately after reconstitution and compare with stored aliquots

  • Consider using freshly prepared protein for critical experiments

Challenge 2: High background in phosphatase assays

Potential causes:

  • Contaminating phosphatases in reagents

  • Non-enzymatic hydrolysis of phosphoinositide substrates

  • Interference from buffer components

Solutions:

  • Use highest purity reagents available

  • Include phosphatase inhibitor cocktails excluding SAC1 inhibitors

  • Perform parallel reactions with heat-inactivated enzyme

  • Optimize substrate concentration to improve signal-to-noise ratio

  • Consider alternative detection methods with higher specificity

Challenge 3: Inconsistent results between experiments

Potential causes:

  • Batch-to-batch variation in recombinant protein

  • Substrate degradation during storage

  • Variation in experimental conditions

Solutions:

  • Maintain consistent protein:substrate ratios across experiments

  • Prepare master mixes for reagents used across multiple experiments

  • Include internal controls in each experiment for normalization

  • Document and strictly control temperature, incubation times, and mixing procedures

  • Create detailed SOPs for critical procedures

Challenge 4: Difficulty in reproducing in vivo activity

Potential causes:

  • Missing cofactors present in cellular environment

  • Absence of interacting proteins or regulatory factors

  • Different lipid membrane composition in vitro vs. in vivo

Solutions:

  • Supplement reactions with zebrafish tissue extracts

  • Test activity in the presence of potential cofactors

  • Use liposomes with more physiological lipid compositions

  • Consider testing activity in cell-free extracts from relevant tissues

Challenge 5: Storage and stability issues

Potential causes:

  • Protein aggregation during freeze-thaw cycles

  • Enzymatic degradation during storage

  • Loss of activity over time

Solutions:

  • Store protein at -80°C in single-use aliquots

  • Add protease inhibitors to storage buffer

  • Maintain 50% glycerol in storage buffer as recommended

  • Monitor activity of reference aliquots over time to establish stability profile

  • Consider fresh preparation for critical experiments

By addressing these common challenges proactively, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant sacm1lb .

How should researchers design experiments to elucidate the substrate specificity of sacm1lb?

Determining the substrate specificity of sacm1lb requires systematic experimental design that addresses both in vitro biochemical properties and in vivo functional specificity:

In vitro substrate profiling strategy:

  • Phosphoinositide panel testing:

    • Prepare a comprehensive panel of phosphoinositide substrates:

      • PI(3)P, PI(4)P, PI(5)P (monophosphates)

      • PI(3,4)P₂, PI(3,5)P₂, PI(4,5)P₂ (bisphosphates)

      • PI(3,4,5)P₃ (trisphosphate)

    • Conduct parallel reactions under identical conditions

    • Measure dephosphorylation rates for each substrate

    • Calculate relative activity and substrate preference

  • Kinetic parameter determination:

    • For preferred substrates, perform concentration gradients (1-100 μM)

    • Determine Km and Vmax values

    • Calculate catalytic efficiency (kcat/Km) for each substrate

    • Compare with known values for mammalian SAC1 phosphatases

  • Competitive substrate assays:

    • Mix equal concentrations of different substrates

    • Analyze products to determine preferential dephosphorylation

    • Vary substrate ratios to assess concentration-dependent effects

Structure-function analysis:

  • Mutational analysis:

    • Generate point mutations in key catalytic residues

    • Create chimeric proteins with domains from sacm1la or mammalian SAC1

    • Express and purify mutant proteins using identical methods

    • Compare activity profiles to identify residues critical for specificity

  • Domain deletion experiments:

    • Generate truncated versions lacking non-catalytic domains

    • Assess how regulatory domains influence substrate preference

    • Compare transmembrane domain mutants to soluble constructs

In vivo substrate determination:

  • Lipidomic profiling:

    • Use CRISPR to generate sacm1lb knockout zebrafish

    • Extract lipids from knockout and wild-type tissues

    • Perform mass spectrometry to quantify all phosphoinositide species

    • Identify specific phosphoinositides that accumulate in knockouts

  • Phosphoinositide sensor imaging:

    • Express fluorescent sensors for different phosphoinositides

    • Compare sensor localization in control and sacm1lb-depleted cells

    • Quantify changes in sensor intensity and distribution

  • Rescue experiments:

    • Reintroduce wild-type sacm1lb in knockout background

    • Express catalytic mutants predicted to abolish activity toward specific substrates

    • Assess which phosphoinositide abnormalities are rescued

Data integration method:

  • Hierarchical clustering:

    • Integrate in vitro preference data with in vivo accumulation data

    • Generate heat maps of substrate specificity

    • Compare with orthologous phosphatases from other species

  • Physiological context consideration:

    • Correlate substrate use with subcellular compartments where sacm1lb localizes

    • Consider temporal aspects of enzyme-substrate interactions

    • Evaluate substrate accessibility in cellular contexts

This systematic approach allows researchers to comprehensively characterize sacm1lb substrate specificity while distinguishing between primary physiological substrates and those that might only be dephosphorylated in artificial in vitro conditions .

What emerging technologies could enhance our understanding of sacm1lb function in zebrafish development and disease models?

Several cutting-edge technologies offer promising approaches for deeper insights into sacm1lb function:

1. Advanced genetic manipulation technologies:

  • Prime editing systems can introduce precise mutations in the sacm1lb gene with reduced off-target effects compared to standard CRISPR/Cas9

  • Inducible degron systems allow temporal control of sacm1lb protein levels, enabling the study of stage-specific functions

  • Base editing for introducing specific point mutations to study structure-function relationships without double-strand breaks

  • Tissue-specific genetic mosaics using Cre-lox or similar systems to study cell-autonomous effects

2. Advanced imaging technologies:

  • Super-resolution microscopy (STORM, PALM, STED) to visualize sacm1lb localization at nanoscale resolution

  • Lattice light-sheet microscopy for long-term, non-phototoxic imaging of sacm1lb dynamics in living zebrafish

  • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructural features

  • Expansion microscopy to physically enlarge specimens for enhanced resolution of sacm1lb subcellular distribution

3. Phosphoinositide detection technologies:

  • Genetically encoded biosensors with improved specificity for different phosphoinositide species

  • Click chemistry-compatible phosphoinositide analogs for pulse-chase experiments

  • Proximity labeling of proteins near specific phosphoinositide pools using modified phosphoinositide-binding domains

  • Single-molecule tracking of phosphoinositide dynamics in living cells

4. Systems biology approaches:

  • Multiomics integration combining transcriptomics, proteomics, and lipidomics data from sacm1lb-deficient zebrafish

  • Network analysis to position sacm1lb within broader signaling and metabolic pathways

  • Computational modeling of phosphoinositide metabolism with kinetic parameters derived from recombinant protein studies

  • Machine learning algorithms to identify patterns in large-scale phenotypic data from sacm1lb mutants

5. Disease modeling technologies:

  • Organoid cultures derived from zebrafish cells to model tissue-specific functions of sacm1lb

  • Patient-derived mutations introduced into zebrafish sacm1lb to model human SAC1-related disorders

  • High-content drug screening in sacm1lb mutant zebrafish to identify potential therapeutic compounds

  • Humanized zebrafish models with human SAC1 replacing zebrafish sacm1lb to directly test human variants

6. Protein structure and interaction technologies:

  • Cryo-electron microscopy to determine high-resolution structures of sacm1lb alone and in complexes

  • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and conformational changes

  • AlphaFold2-based structural predictions combined with experimental validation

  • Protein-protein interaction mapping using BioID, APEX proximity labeling, or complementation assays

Implementation of these technologies will allow researchers to develop a more comprehensive understanding of sacm1lb function across multiple scales, from molecular mechanisms to whole-organism physiology and potential disease relevance .

How can researchers integrate sacm1lb studies with broader phosphoinositide signaling networks in developmental and disease contexts?

Integrating sacm1lb research with broader phosphoinositide signaling networks requires multidisciplinary approaches that connect molecular mechanisms to physiological outcomes:

Comprehensive experimental framework:

  • Multi-enzyme analysis:

    • Study sacm1lb in conjunction with kinases that generate its substrates

    • Examine interactions with other phosphoinositide phosphatases

    • Create double mutants (sacm1lb + related enzymes) to identify compensatory mechanisms

    • Develop mathematical models of phosphoinositide cycling incorporating multiple enzymes

  • Signaling pathway integration:

    • Map connections between sacm1lb activity and downstream effectors

    • Investigate cross-talk with major signaling pathways (Wnt, Notch, FGF, etc.)

    • Analyze effects of sacm1lb manipulation on calcium signaling and PKC activation

    • Examine impact on mTOR signaling, which is regulated by phosphoinositides

  • Developmental context analysis:

    • Characterize spatial and temporal expression patterns of sacm1lb throughout development

    • Correlate with expression of other phosphoinositide-metabolizing enzymes

    • Identify critical developmental windows where sacm1lb function is essential

    • Map phosphoinositide distributions during key developmental events

Table: Potential Disease Models for sacm1lb Research

Disease CategoryHuman SAC1 RelevanceZebrafish Model ApproachKey Readouts
Neurodevelopmental disordersSAC1 mutations linked to intellectual disabilitysacm1lb knockout focused on CNS development- Neural migration
- Synapse formation
- Behavioral assays
Metabolic disordersSAC1 regulates lipid homeostasisLiver-specific sacm1lb depletion- Lipid accumulation
- Glucose metabolism
- Stress responses
Cancer modelsAltered PI4P levels in multiple cancersCombination with oncogene expression- Cell proliferation
- Migration/invasion
- Angiogenesis
CiliopathiesSAC1 regulates ciliary phosphoinositidesFocus on ciliated tissues in sacm1lb mutants- Cilia formation
- Cilia function
- Left-right asymmetry
Muscle disordersPhosphoinositides regulate excitation-contraction couplingMuscle-specific sacm1lb manipulation- Muscle development
- Contraction
- Calcium handling

Methodological integration strategies:

  • Temporal control systems:

    • Use heat-shock or chemical-inducible promoters to control sacm1lb expression

    • Apply optogenetic tools to activate or inhibit sacm1lb in specific cells

    • Implement fast-acting chemical inhibitors for acute manipulation

    • Compare chronic vs. acute loss of function

  • Spatial manipulation approaches:

    • Employ tissue-specific promoters to drive sacm1lb expression

    • Use cell transplantation to create genetic mosaics

    • Apply localized CRISPR delivery for region-specific editing

    • Utilize subcellular targeting sequences to restrict sacm1lb to specific compartments

  • Quantitative analysis methods:

    • Develop standardized phenotyping pipelines for sacm1lb mutants

    • Implement machine learning for unbiased phenotype classification

    • Use single-cell approaches to account for cellular heterogeneity

    • Apply systems biology tools to integrate diverse datasets

  • Translational research approaches:

    • Compare zebrafish findings with mammalian models

    • Establish links between sacm1lb phenotypes and human SAC1-related disorders

    • Develop high-throughput screens for compounds that modulate sacm1lb activity

    • Create zebrafish avatars of human SAC1 mutations for personalized medicine

By implementing these integrated approaches, researchers can position sacm1lb within the broader context of phosphoinositide biology and leverage the unique advantages of the zebrafish model system to generate insights relevant to both basic biology and human disease .

What key considerations should researchers keep in mind when planning experiments with recombinant sacm1lb?

When planning experiments with recombinant Danio rerio Phosphatidylinositide phosphatase SAC1-B (sacm1lb), researchers should carefully consider several critical factors to ensure robust and reproducible results:

  • Expression system selection: The choice between E. coli, yeast, baculovirus, or mammalian expression systems significantly impacts protein characteristics. This decision should be guided by the specific experimental requirements, with E. coli providing high yields but limited post-translational modifications, while mammalian systems offer more native-like protein at higher cost and lower yield .

  • Protein quality assessment: Before conducting functional experiments, thorough quality control is essential. This includes verification of >85% purity by SDS-PAGE, confirmation of proper folding through circular dichroism or thermal shift assays, and preliminary activity testing to ensure the recombinant protein is functional .

  • Storage and handling protocols: Strict adherence to recommended storage conditions (-20°C/-80°C) and proper handling procedures is crucial for maintaining enzyme activity. Researchers should prepare single-use aliquots with 50% glycerol to minimize freeze-thaw cycles and should validate protein stability over time through periodic activity testing .

  • Comprehensive controls: Experimental design must incorporate appropriate positive and negative controls, including heat-inactivated enzyme, catalytically inactive mutants, and parallel assays with related phosphatases. These controls help distinguish specific sacm1lb activity from background signals or contaminating activities .

  • Physiological relevance: Researchers should consider how in vitro conditions relate to the in vivo environment. This includes using physiologically relevant substrate concentrations, incorporating appropriate cofactors, and considering the membrane context in which sacm1lb naturally functions .

By addressing these key considerations, researchers can maximize the reliability of their experiments with recombinant sacm1lb and generate more meaningful insights into phosphoinositide metabolism in zebrafish and related model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.