Recombinant Danio rerio Phosphatidylserine synthase 1 (ptdss1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Danio rerio Phosphatidylserine Synthase 1 (ptdss1) is a laboratory-engineered form of the enzyme phosphatidylserine synthase 1 (PSS1) derived from zebrafish (Danio rerio). This enzyme catalyzes the calcium-dependent base-exchange reaction where L-serine replaces the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) to synthesize phosphatidylserine (PS), a phospholipid critical for membrane structure, apoptosis, and cell signaling . PS constitutes 5–10% of cellular membrane phospholipids and plays roles in blood coagulation and mineralisation .

Membrane Topology

PTDSS1 is a multi-pass transmembrane protein localized to the endoplasmic reticulum (ER). Recent studies using epitope tagging and immunofluorescence support a 10-transmembrane segment model (Figure 1), where:

  • Catalytic residues (e.g., eight critical amino acids) are positioned on the luminal side of the ER membrane.

  • Regulatory residues (e.g., nine amino acids) reside on the cytoplasmic side, enabling PS-mediated feedback inhibition .

Amino Acid Sequence

The recombinant zebrafish PTDSS1 (UniProt ID: Q803C9) comprises 465 amino acids. Key domains include:

  • A conserved serine-exchange motif critical for substrate binding .

  • N-terminal His-tag for purification (e.g., in E. coli or HEK293 expression systems) .

Table 2: Biochemical Properties

PropertyDetail
Molecular Weight~55–60 kDa (including tags)
Expression SystemE. coli, HEK293, mammalian cells
Tag TypesHis, GST, Avi, or untagged

Enzyme Activity Assays

Recombinant PTDSS1 is used to study PS biosynthesis kinetics. For example:

  • C14-serine incorporation assays measure PS/PE synthesis rates in transfected HEK293 cells .

  • Mutant variants (e.g., Leu137Phe) show loss-of-function, aiding studies on Lenz-Majewski syndrome (LMHD), a hyperostotic dwarfism disorder linked to PTDSS1 gain-of-function mutations .

Disease Modeling

LMHD-associated mutations (e.g., P269S) disrupt PS homeostasis, leading to dysregulated bone mineralization. Recombinant zebrafish PTDSS1 enables cross-species comparative studies of these mechanisms .

Pathway Involvement

PTDSS1 participates in glycerophospholipid metabolism, interacting with enzymes like PTDSS2 and PLB1.

Table 3: Key Pathway Interactions

PathwayAssociated Proteins
Glycerophospholipid metabolismPTDSS2, PLB1, CDS2, DGKG
Metabolic pathwaysHMGCR, CYP2C70, FBP1

Research Significance

Recombinant zebrafish PTDSS1 bridges structural biology and disease research:

  • Clarifies evolutionary conservation of PS synthesis mechanisms across vertebrates .

  • Facilitates drug screening for PS-related disorders, including LMHD and coagulation abnormalities .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
ptdss1; si:ch211-269k10; zgc:55906; Phosphatidylserine synthase 1; PSS-1; PtdSer synthase 1; Serine-exchange enzyme I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ptdss1
Target Protein Sequence
MATTFRSQTLSKDDVNYRMHFRMINEQQVEDITIQFFYKPHTISLLTVTVLSLMYFAFTR DDGDPDSNLRVGLILLVSFFLVISVLAFPNGPFTRPHPAIWRIVFGLSVLYFLFLVFIIF LNWDQVKALMFWLDPNLRYAKREADVMEYAVNCHVITWERILSHFDIFAFSHFWGWGMKA LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMTVCRFL EMRTYHWASIKDIHSTTGKIKRAVLQFTPASWTYVRWLDPKSSLQRVMGVYLFMIIWQLT ELNTFFLKHIFVFPACHALSWCRILFIGIITAPTVRQYYAYLTDTQCKRVGTQCWVFGAI AFLEALACIKFGQDLFSKTQILYVILWLVCLAFITFLCLYVMVWYAENYGPRQKSFSECE DSIYSEAGDSVTECKGEFEIDSTTSCSTRKRRDSGDSRTINGMEK
Uniprot No.

Target Background

Function

This enzyme catalyzes a base-exchange reaction, substituting the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) with L-serine. While primarily catalyzing phosphatidylcholine conversion, it also converts phosphatidylethanolamine in vitro, albeit to a lesser extent.

Database Links
Protein Families
Phosphatidyl serine synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylserine synthase 1 (PTDSS1) and what is its function in Danio rerio?

Phosphatidylserine synthase 1 (PTDSS1), also known as PSS-1 or PtdSer synthase 1 (EC 2.7.8.29), is an enzyme responsible for catalyzing the synthesis of phosphatidylserine (PtdSer) in zebrafish. In Danio rerio, PTDSS1 functions as a serine-exchange enzyme that catalyzes the exchange of L-serine with the base moieties of phosphatidylcholine to form phosphatidylserine . This enzyme plays a critical role in the metabolism of amino-glycerophospholipids and membrane phospholipid composition, which is essential for normal cellular function and development in zebrafish.

How conserved is PTDSS1 across species, particularly between zebrafish and mammals?

PTDSS1 shows significant evolutionary conservation between zebrafish and mammals. Human and zebrafish PTDSS1 orthologues share 78% amino acid identity, indicating substantial functional conservation across vertebrate species . This high level of conservation suggests that the fundamental mechanisms of phosphatidylserine synthesis have been preserved throughout vertebrate evolution. The zebrafish PTDSS1 protein contains 465 amino acids with several conserved domains that are also present in mammalian counterparts . When comparing with Chinese hamster PSS1 and PSS2, these enzymes share approximately 32% amino acid identity with each other, with numerous conserved polar amino acid residues that are critical for enzymatic function .

What expression systems are used to produce recombinant Danio rerio PTDSS1?

Recombinant Danio rerio PTDSS1 can be produced using several expression systems, though the specific system may vary depending on experimental needs. The recombinant PTDSS1 protein available commercially is typically produced using bacterial or eukaryotic expression systems that have been optimized for protein folding and post-translational modifications. The expression region typically includes amino acids 1-465, representing the full-length protein . The recombinant protein is often supplied with a tag (determined during the production process) to facilitate purification and detection in experimental settings.

What are the optimal storage conditions for recombinant Danio rerio PTDSS1?

For optimal stability and activity of recombinant Danio rerio PTDSS1, the protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, it is recommended to store the protein at -20°C or -80°C . It is important to note that repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of enzymatic activity. For short-term use, working aliquots can be stored at 4°C for up to one week . Proper storage conditions are essential for maintaining the structural integrity and functional activity of the enzyme in experimental settings.

Which amino acid residues are critical for the catalytic activity of PTDSS1?

Based on systematic alanine mutagenesis studies of the related Chinese hamster PSS1, eight amino acid residues have been identified as crucial for serine base-exchange activity: His-172, Glu-197, Glu-200, Asn-209, Glu-212, Asp-216, Asp-221, and Asn-226 . Among these, Asn-209 appears to be particularly important for the recognition and/or binding of free L-serine . Given the high conservation between species, these residues likely play similar roles in Danio rerio PTDSS1.

The critical catalytic residues can be grouped based on their roles in the enzymatic mechanism:

Amino Acid ResidueProposed Function in Enzymatic Activity
His-172Potentially involved in proton transfer during catalysis
Glu-197, Glu-200May participate in substrate binding or catalytic mechanism
Asn-209Involved in recognition/binding of L-serine substrate
Glu-212, Asp-216, Asp-221Likely contribute to active site architecture
Asn-226May be involved in stabilizing the transition state

These findings suggest that PTDSS1 employs a complex catalytic mechanism involving multiple amino acid residues that work in concert to facilitate the serine base-exchange reaction .

How does feedback regulation of PTDSS1 occur at the molecular level?

PTDSS1 activity is subject to feedback inhibition by its product, phosphatidylserine (PtdSer). This regulatory mechanism has been demonstrated in both intact cells and isolated membrane fractions . Six amino acid residues have been identified as critical for this feedback regulation in Chinese hamster PSS1: Arg-95, His-97, Cys-189, Arg-262, Gln-266, and Arg-336 .

When these residues are mutated to alanine, the resulting mutant enzymes show resistance to inhibition by exogenous PtdSer, suggesting that these residues participate in PtdSer-mediated inhibition of PTDSS1 . Interestingly, mutations affecting these regulatory residues result in enhanced PtdSer synthesis even in the absence of exogenous PtdSer, indicating that these residues are involved in both the basal regulation of enzyme activity and the response to exogenous PtdSer .

The regulatory mechanism appears to involve specific interactions between PtdSer and these key regulatory residues, which likely induce conformational changes in the enzyme that modulate its catalytic activity. For instance, when Arg-95 is mutated, binding of PtdSer to a putative regulatory site may cause activation instead of inhibition, possibly by stabilizing a different enzyme conformation .

What experimental approaches can be used to study PTDSS1 mutations associated with human disorders in zebrafish models?

Zebrafish models offer valuable platforms for studying the effects of PTDSS1 mutations associated with human disorders such as Lenz-Majewski syndrome (LMS). Several experimental approaches can be employed:

  • RNA Microinjection: Injecting physiologically high doses of RNA encoding human mutant forms of PTDSS1 into zebrafish embryos has been shown to cause developmental defects including axial abnormalities, eye loss, and jaw cartilage patterning defects . The frequency of these defects correlates with RNA dose, providing a biochemical readout of LMS gain-of-function mutation activity.

  • Transgenesis: Tol2 transposon-mediated transgenesis can be used to create stable transgenic zebrafish lines expressing wild-type or mutant forms of human PTDSS1 . This approach allows for tissue-specific expression using appropriate promoters, such as:

    • Ubiquitous expression

    • Chondrocyte-specific expression

    • Osteoblast-specific expression

    • Osteoclast-specific expression

  • CRISPR/Cas9 Gene Editing: Creating precise mutations in the endogenous zebrafish ptdss1 gene that mirror human disease mutations can provide more physiologically relevant models of LMS.

What methods can be employed to measure PTDSS1 enzymatic activity in zebrafish tissue samples?

Measuring PTDSS1 enzymatic activity in zebrafish tissue samples requires specific biochemical assays that detect the serine base-exchange reaction. Several methodological approaches include:

  • Radioisotope Labeling: Incubating tissue homogenates or isolated membranes with radioactively labeled L-serine (e.g., [³H]serine or [¹⁴C]serine) and measuring the incorporation of the labeled serine into phosphatidylserine.

  • Mass Spectrometry: Using liquid chromatography-mass spectrometry (LC-MS) to quantify the formation of phosphatidylserine from phosphatidylcholine and free L-serine in tissue extracts.

  • Fluorescent Substrate Assays: Utilizing fluorescently labeled phospholipid substrates to monitor the base-exchange reaction in real-time.

  • Cell Homogenate Assays: Preparing homogenates from zebrafish tissues and measuring PtdSer synthesis in the presence and absence of exogenous PtdSer to assess both catalytic activity and feedback regulation .

When designing these assays, it is crucial to consider the optimal reaction conditions:

  • Buffer composition (typically Tris-based)

  • pH (usually in the physiological range)

  • Divalent cation requirements

  • Substrate concentrations

  • Temperature (typically 25-30°C for zebrafish enzyme assays)

Additionally, comparing wild-type PTDSS1 activity with that of mutant variants can provide insights into how specific amino acid residues contribute to catalytic function and regulation.

How does PTDSS1 function affect membrane composition and cellular signaling in developing zebrafish embryos?

PTDSS1 plays a critical role in determining membrane phospholipid composition by catalyzing the production of phosphatidylserine (PtdSer), which in turn affects various cellular processes in developing zebrafish embryos. PtdSer is primarily located in the inner leaflet of plasma membranes and serves multiple functions:

  • Membrane Architecture: PtdSer contributes to membrane asymmetry and physical properties, which are essential for membrane protein function and cellular processes.

  • Cell Signaling: PtdSer externalization serves as an important signal for various cellular processes, including apoptosis and the clearance of dying cells during embryonic development.

  • Calcium-Dependent Protein Binding: Many signaling proteins contain domains that bind PtdSer in a calcium-dependent manner, affecting signal transduction pathways.

Research has shown that altered PTDSS1 function, particularly gain-of-function mutations, can lead to developmental abnormalities in zebrafish embryos, including axial defects, eye loss, and jaw cartilage patterning defects . These phenotypes suggest that dysregulated PtdSer synthesis disrupts normal developmental processes, possibly through altered cell signaling pathways or membrane protein function.

In addition, there appears to be a connection between PTDSS1 function and skeletal development, as transgenic zebrafish with altered PTDSS1 expression exhibited incompletely penetrant mild scoliosis of the vertebrae . This suggests that proper regulation of phospholipid metabolism is important for normal skeletal development and homeostasis.

What are the key considerations when designing experiments to study structure-function relationships of Danio rerio PTDSS1?

When investigating structure-function relationships of Danio rerio PTDSS1, researchers should consider several important factors:

  • Mutagenesis Strategy: Systematic alanine scanning mutagenesis has proven effective for identifying critical residues in PSS1 . For Danio rerio PTDSS1, focusing on conserved polar amino acid residues that are shared with other species can be particularly informative.

  • Expression Systems: Choose appropriate expression systems that allow for proper protein folding and post-translational modifications. Mammalian cell lines (such as CHO-K1 cells) have been successfully used for expressing PSS1 mutants .

  • Membrane Protein Challenges: PTDSS1 is a membrane protein with multiple transmembrane domains, which can present challenges for expression, purification, and structural studies. Consider using detergents or nanodiscs for stabilizing the protein in solution.

  • Functional Assays: Develop robust assays to measure both enzymatic activity and regulatory properties. Base-exchange activity can be measured using radioactive or fluorescent substrates, while regulatory properties can be assessed by examining the response to exogenous PtdSer .

  • Protein Stability: Some mutations may affect protein stability rather than directly impacting catalytic or regulatory function. Western blot analysis can help distinguish between mutations that affect protein expression/stability versus those that affect function .

How can contradictory results in PTDSS1 research be reconciled and addressed methodologically?

When faced with contradictory results in PTDSS1 research, consider these methodological approaches to reconcile discrepancies:

  • Experimental Conditions: Differences in buffer composition, pH, temperature, or substrate concentrations can significantly impact enzyme activity measurements. Standardizing these conditions across laboratories is essential for comparing results.

  • Species-Specific Differences: Despite high conservation, PTDSS1 from different species may exhibit subtle functional differences. When comparing results across species, consider the degree of sequence conservation in the specific regions under investigation.

  • Expression System Variations: The choice of expression system can affect protein folding, post-translational modifications, and membrane incorporation, potentially leading to functional differences in recombinant PTDSS1 proteins.

  • In vitro versus In vivo Studies: Results from in vitro enzymatic assays may not always align with observations in cellular or organismal models due to the complex regulatory environment in living systems.

  • Technical Replication: Ensuring robust technical replication and appropriate statistical analysis is critical for validating experimental findings and identifying potential sources of variability.

  • Complementary Approaches: Employing multiple experimental techniques (e.g., combining biochemical assays with structural studies and cellular models) can provide a more comprehensive understanding of PTDSS1 function and help resolve apparent contradictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.