Recombinant Danio rerio Phosphatidylserine synthase 2 (ptdss2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Danio rerio PTDSS2 is a 452-amino acid transmembrane protein (Uniprot ID: E7EY42) with a molecular weight dependent on post-translational modifications. Key structural features include:

PropertyDetail
Catalytic ActivityBase-exchange reaction converting phosphatidylethanolamine to phosphatidylserine
Enzyme Commission NumberEC 2.7.8.29
Expression SystemProduced in E. coli, HEK293, or mammalian cell systems
Purity≥85% as verified by SDS-PAGE

The full-length protein includes domains critical for substrate binding and calcium-dependent activity, as evidenced by its conserved serine-exchange motif .

Biochemical Function and Regulation

PTDSS2 specifically catalyzes the conversion of phosphatidylethanolamine (PE) to phosphatidylserine (PS) via a calcium-dependent mechanism. Key functional insights include:

  • Substrate Specificity: Unlike PTDSS1, PTDSS2 shows negligible activity toward phosphatidylcholine (PC) .

  • Regulatory Mechanism: PS synthesis is inhibited by exogenous PS through direct interaction with PTDSS2, as demonstrated in purified enzyme assays .

  • Pathway Involvement: Central to glycerophospholipid metabolism, interacting with proteins like phosphatidylserine decarboxylase (PISD) and choline/ethanolamine phosphotransferase (CEPT1) .

Research Applications

Recombinant PTDSS2 is utilized in:

  • Enzyme Kinetics Studies: Purified PTDSS2 enables in vitro analysis of PS synthesis rates under varying calcium concentrations .

  • Drug Discovery: Screens for lipid metabolism modulators targeting neurodegenerative or metabolic disorders .

  • Structural Biology: Used in crystallography trials to map catalytic sites .

Interaction Network

STRING-db analysis identifies key functional partners in zebrafish:

Interacting ProteinFunctionInteraction Score
PisdConverts PS to PE via decarboxylation0.957
Cept1a/bSynthesizes phosphatidylcholine/ethanolamine from CDP-choline/ethanolamine0.940–0.942
Ptdss1aPS synthase with PC substrate preference0.935

Technical Considerations

  • Activity Assays: Requires detergent-solubilized membranes for optimal function .

  • Inhibition Data: IC₅₀ for PS-mediated inhibition is 10–20 μM in cell-free systems .

  • Species Cross-Reactivity: Zebrafish PTDSS2 shares 68% sequence homology with human orthologs, enabling translational studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
ptdss2; si:ch1073-158c2; si:ch1073-279O1; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ptdss2
Target Protein Sequence
MAKGEWKRSGADDLPLPGRSECEVFDDGTNTFFWRAHTVTVLFILTCALVYVTLLEETPH DTAYNTKRGIVASILVFLCFGVTQAKDGPFTRPHPAYWRFWLCVSVVYELFLIFILFQTV HDGRQFMKYIDPKLGVPLPERGYGGNCLIYDPGHPTDPFHNIWDKMDGFVPAHFLGWYIK TLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLGW LSMKPYQWQGLWNIPTYKGKIKRIAFQFTPYSWVKFEWRPASNLRRWLAVLGIIFMFLLA ELNTFYLKFVMWMPPEHYLVLFRLVFFVNVGGVAMREIYDFMDDPKFHKKLGQQAWIVAA ITVTEFLIVVKYDPNTIMLPIPFFITQCWILGIALILVWTLWRFFIRDITLRYKETRRRR QEVSSERDGSSSAPSGRSKLNGSMDSVRHRKS
Uniprot No.

Target Background

Function
Phosphatidylserine synthase 2 (Ptsss2) from Danio rerio catalyzes a base-exchange reaction involving the replacement of the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) with L-serine. It specifically catalyzes the conversion of phosphatidylethanolamine and does not act on phosphatidylcholine. Both phosphatidylethanolamine (PE) plasmalogen and diacyl PE can be utilized as substrates, with the latter being six times more efficient. This highlights the importance of an ester linkage at the sn-1 position. While exhibiting no preference for sn-1 fatty acyl, the enzyme shows a strong preference for docosahexaenoic acid (22:6n-3) at the sn-2 position compared to 18:1 or 20:4.
Database Links
Protein Families
Phosphatidyl serine synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Phosphatidylserine synthase 2 (ptdss2) and what is its function in zebrafish?

Phosphatidylserine synthase 2 (ptdss2), also known as PSS-2 or PtdSer synthase 2 (EC 2.7.8.29), is an enzyme responsible for catalyzing the synthesis of phosphatidylserine, a critical phospholipid component of cell membranes in Danio rerio (zebrafish) . This enzyme functions primarily through a base-exchange reaction where it replaces the head group of phosphatidylcholine or phosphatidylethanolamine with serine. The protein is encoded by the ptdss2 gene, which has alternative names including si:ch1073-158c2 and si:ch1073-279O1 in zebrafish genomic databases .

In mammals, PTDSS2 works redundantly with PTDSS1 to maintain cellular phosphatidylserine levels, which are essential for multiple cellular processes including apoptotic cell clearance, blood coagulation, and proper membrane topology . The zebrafish ortholog shares significant homology with mammalian PTDSS2, suggesting evolutionary conservation of function. Structurally, the zebrafish ptdss2 protein contains multiple transmembrane domains characteristic of membrane-bound enzymes involved in phospholipid synthesis pathways.

What are the standard methods for studying ptdss2 expression in zebrafish models?

Several established techniques can be employed to study ptdss2 expression in zebrafish models. In situ hybridization represents one of the most fundamental approaches, allowing visualization of gene expression patterns in intact embryos or tissue sections . For this technique, researchers design antisense mRNA probes that specifically recognize and bind to ptdss2 transcripts, which can then be detected using either color-based or fluorescence-based assays . The classical color-based approach uses chromogenic substrates visualized through light microscopy, whereas fluorescent detection enables simultaneous visualization of multiple targets, with recent optimizations allowing detection of up to five probes using Hybridization Chain Reaction (HCR) amplification .

Quantitative real-time PCR (qRT-PCR) provides a more precise measurement of ptdss2 transcript levels. This method requires careful RNA extraction, typically using reagents like ISOGEN II, followed by quality assessment via spectrophotometry (A280/A260 ratio) and fragment analysis . For comprehensive transcriptional profiling, RNA sequencing (RNA-seq) can reveal how ptdss2 expression changes under different experimental conditions, such as after dietary supplementation or genetic manipulation . When preparing RNA-seq libraries, it's essential to ensure complete digestion of genomic DNA and verify RNA quality using tools like the Qsep100 DNA Fragment Analyzer before proceeding with library preparation protocols .

How do researchers generate zebrafish models with altered ptdss2 function?

For stable genetic modification, the Tol2 transposon system has become the gold standard in zebrafish transgenesis . This system requires construction of a plasmid containing the desired DNA fragment (either for overexpression or knockdown of ptdss2) flanked by minimal Tol2 cis-regulatory elements. The plasmid, along with mRNA encoding Tol2 transposase, is injected into one-cell stage embryos, facilitating genomic integration . This system can accommodate inserts up to 11 kb in size, allowing for complex constructs with tissue-specific promoters driving expression of fluorescent reporters or modified versions of ptdss2 .

More recently, CRISPR/Cas9 technology has revolutionized genetic manipulation in zebrafish, enabling precise genomic alterations in ptdss2. The technique involves co-injection of guide RNAs targeting specific regions of the ptdss2 gene along with Cas9 mRNA or protein, resulting in targeted mutations that can be bred to homozygosity in subsequent generations. This approach allows for complete gene knockout or introduction of specific mutations to study structure-function relationships in the ptdss2 protein.

How does ptdss2 expression correlate with social environment in zebrafish, and what methodological approaches best capture these dynamics?

Recent research has revealed fascinating correlations between social environmental factors and gene expression patterns in zebrafish, though most studies have focused on other neuropeptides such as pth2 rather than ptdss2 directly . To study potential social environment effects on ptdss2 expression, researchers should consider implementing a multi-faceted experimental design that accounts for temporal dynamics. Studies on pth2 have demonstrated that social isolation specifically decreases transcript levels, while just 30 minutes of exposure to conspecifics initiates significant transcript rescue . Similar bidirectional dynamics may exist for phospholipid synthesis genes like ptdss2, given the importance of membrane remodeling in neuronal plasticity.

The optimal methodological approach would include both acute and chronic social manipulation protocols. Fish should be maintained in standardized conditions (temperature 25 ± 2°C, 14:10 hour light/dark cycle) with consistent feeding schedules . Experimental groups should include socially reared, acutely isolated, chronically isolated, and re-socialized cohorts. Temporal sampling is critical—collecting tissue at multiple timepoints following social state changes allows capturing the dynamic expression profile. For transcript quantification, qRT-PCR offers targeted sensitivity, while RNA-seq provides broader contextual data on related pathways . When designing primers for ptdss2, researchers should carefully check for paralogous sequences to ensure specificity, particularly given the evolutionary relationship between ptdss1 and ptdss2.

Statistical analysis should employ repeated measures designs when possible, with appropriate corrections for multiple comparisons. To capture potential heterogeneity in response, single-cell RNA sequencing may reveal cell type-specific effects that could be masked in whole-tissue analysis. Correlation with behavioral metrics provides valuable functional context to expression changes.

What is the relationship between ptdss1 and ptdss2 in zebrafish, and how can researchers differentiate their specific functions experimentally?

The relationship between ptdss1 and ptdss2 in zebrafish parallels the functional redundancy observed in mammals, where both enzymes contribute to phosphatidylserine synthesis through distinct but overlapping mechanisms . Differentiating their specific functions requires sophisticated experimental approaches that selectively manipulate each enzyme while monitoring cellular and physiological outcomes. The fundamental challenge stems from their overlapping functions—when one enzyme is compromised, the other may compensate, potentially masking phenotypes in single-gene perturbation studies.

To address this challenge, researchers should implement a systematic knockout strategy using CRISPR/Cas9 to generate single ptdss1 and ptdss2 knockouts, as well as conditional double knockouts, as complete loss of both enzymes may be lethal. Tissue-specific or inducible promoters driving Cre recombinase in a floxed allele background can provide temporal and spatial control over gene deletion. Subsequent phospholipidomic analysis using liquid chromatography-mass spectrometry (LC-MS) can quantify changes in phosphatidylserine levels and related phospholipids across different tissues and developmental stages.

Rescue experiments offer another powerful approach—introducing wild-type or mutant versions of each gene into the corresponding knockout background can reveal structure-function relationships and substrate preferences. For example, researchers might introduce human PTDSS1 or PTDSS2 into zebrafish knockouts to assess evolutionary conservation of function. Additionally, pulse-chase experiments with radiolabeled serine can determine the relative contribution of each enzyme to phosphatidylserine synthesis under different physiological conditions or stresses.

A particularly elegant approach would utilize selective inhibitors like those developed for PTDSS1 , which could be applied to zebrafish with genetically modified ptdss2 to reveal compensatory mechanisms and identify cellular processes particularly dependent on each enzyme. This approach could be complemented with transcriptomic and proteomic analyses to identify differential gene expression patterns in response to selective enzyme inhibition.

What are the optimal conditions for studying recombinant Danio rerio ptdss2 in vitro, and how should researchers address enzyme activity assays?

The in vitro characterization of recombinant Danio rerio ptdss2 requires careful consideration of expression systems, purification protocols, and enzyme activity assays. For recombinant expression, several systems can be employed, with each offering distinct advantages. Bacterial expression systems (E. coli) provide high protein yields but may struggle with proper folding of membrane proteins like ptdss2. Insect cell systems (Sf9, Hi5) offer improved eukaryotic folding machinery, while mammalian cells provide the most native-like post-translational modifications. For membrane proteins, expression constructs should include purification tags (His, FLAG, etc.) positioned to minimize interference with enzyme function, and detergent screens are essential to identify conditions that maintain enzyme activity during solubilization .

Enzyme activity assays for ptdss2 typically measure the incorporation of radiolabeled serine into phospholipids or the production of other reaction products. A standard assay involves incubating the purified enzyme with phosphatidylcholine or phosphatidylethanolamine substrates and [³H]-L-serine, followed by lipid extraction and thin-layer chromatography or HPLC separation. Activity should be assessed across a range of pH values (typically pH 6.5-8.5), temperatures (25-37°C), and divalent cation concentrations, as these parameters can significantly affect catalytic efficiency. Controls should include heat-inactivated enzyme and selective inhibitors when available.

When interpreting results, researchers should be aware that the recombinant protein may display altered kinetic parameters compared to the native enzyme due to differences in lipid environment or post-translational modifications. To address this, parallel assays with native membranes or reconstituted proteoliposomes can provide valuable comparisons. Additionally, the full-length recombinant protein sequence for Danio rerio ptdss2 is available (452 amino acids) , allowing for structure-function studies through site-directed mutagenesis of predicted catalytic or regulatory domains.

How can researchers effectively integrate ptdss2 studies with broader phospholipid metabolism investigations in zebrafish models?

Integrating ptdss2 studies within the broader context of phospholipid metabolism in zebrafish requires a multi-omics approach that connects genotype to phenotype across various biological scales. At the genomic level, researchers should begin by mapping the complete phospholipid synthesis pathway in zebrafish, identifying all enzymes involved and their genetic relationships. This provides the foundation for designing targeted genetic manipulations that can reveal how ptdss2 interacts with other components of the pathway.

Lipidomic analysis represents the cornerstone of such integrated studies. Techniques such as liquid chromatography-mass spectrometry (LC-MS/MS) or matrix-assisted laser desorption/ionization (MALDI) imaging allow precise quantification of phosphatidylserine and other phospholipids in different tissues and developmental stages. When designing lipidomic experiments, researchers should include multiple time points to capture dynamic changes and consider both tissue-specific and subcellular fractionation approaches, as phospholipid composition varies significantly between organelles.

Transcriptomic data can reveal compensatory mechanisms that may be activated when ptdss2 function is altered. RNA-seq protocols optimized for zebrafish, including proper RNA extraction methods and quality control steps , should be employed across relevant tissues. Data analysis should focus not only on ptdss1 expression (the most obvious compensatory mechanism) but also on broader phospholipid synthesis and remodeling pathways. To integrate transcriptomic and lipidomic data effectively, multivariate statistical methods such as principal component analysis or partial least squares discriminant analysis can identify correlations between gene expression patterns and lipid profiles.

Functional validation of these integrated datasets can be achieved through in vivo imaging of phospholipid dynamics using fluorescent phosphatidylserine sensors or radiolabeled precursors. Additionally, phenotypic analyses should assess processes known to be dependent on proper phosphatidylserine distribution, such as apoptotic cell clearance, neural development, and blood coagulation, providing functional context to molecular alterations.

What statistical approaches are most appropriate for analyzing ptdss2 expression data across different experimental conditions?

The statistical analysis of ptdss2 expression data requires careful consideration of experimental design, data distribution characteristics, and biological variability. For qRT-PCR data, relative quantification using the 2^(-ΔΔCT) method represents the standard approach, but researchers must carefully select and validate appropriate reference genes that remain stable across experimental conditions. Multiple reference genes (at least three) should be evaluated using algorithms such as geNorm or NormFinder before normalization to improve reliability.

When comparing ptdss2 expression across multiple experimental conditions, researchers should first assess data normality using Shapiro-Wilk or Kolmogorov-Smirnov tests. For normally distributed data with homogeneous variances, parametric tests such as Student's t-test (two groups) or ANOVA (multiple groups) with appropriate post-hoc tests (Tukey's, Bonferroni, etc.) can be employed. Non-parametric alternatives include Mann-Whitney U test (two groups) or Kruskal-Wallis test (multiple groups) followed by Dunn's post-hoc test.

Longitudinal studies examining ptdss2 expression over time or development require repeated measures ANOVA or mixed-effects models that can account for within-subject correlations. For complex experimental designs with multiple factors (e.g., genotype, treatment, time), factorial ANOVA or general linear models provide a robust framework for identifying main effects and interactions. Power analysis should be conducted during experimental planning to ensure sufficient sample sizes for detecting biologically relevant changes in ptdss2 expression with adequate statistical power (typically 0.8 or higher).

How should researchers interpret contradictory findings regarding ptdss2 function between in vitro biochemical studies and in vivo zebrafish models?

Contradictions between in vitro and in vivo findings regarding ptdss2 function represent a common challenge in molecular biology research that requires careful methodological consideration and integrated analysis approaches. Several factors may contribute to such discrepancies: in vitro systems lack the complex regulatory networks and compensatory mechanisms present in whole organisms; recombinant proteins may exhibit altered properties compared to native enzymes due to differences in post-translational modifications or membrane environments; and temporal aspects of enzyme function may be difficult to capture in static biochemical assays.

When facing such contradictions, researchers should first carefully evaluate methodological differences that might explain the discrepant results. For in vitro studies using recombinant ptdss2, factors such as protein tags, purification methods, detergent choice, and assay conditions can significantly affect enzyme activity . Similarly, for in vivo studies, the method of genetic manipulation (transient morpholino knockdown versus stable genetic mutants), developmental timing, and tissue specificity of analysis can all influence outcomes.

To reconcile contradictory findings, integrated approaches that bridge in vitro and in vivo systems offer valuable solutions. These might include:

  • Reconstitution experiments where purified recombinant ptdss2 is incorporated into liposomes with compositions mimicking native membranes, providing a more physiologically relevant context for biochemical assays.

  • Ex vivo approaches using membrane preparations from zebrafish tissues, which maintain native protein complexes and lipid environments while allowing controlled biochemical manipulations.

  • Genetic complementation studies where mutant forms of ptdss2 identified in biochemical studies are expressed in ptdss2-null zebrafish to validate structure-function relationships in vivo.

  • Spatial and temporal profiling of ptdss2 activity using activity-based protein profiling or metabolic labeling approaches, which can reveal context-dependent enzyme functions that might explain apparently contradictory results.

Additionally, researchers should consider that apparent contradictions might actually reflect biologically meaningful complexity rather than methodological artifacts. The function of ptdss2 may genuinely differ between contexts due to factors such as substrate availability, formation of different protein complexes, or regulatory modifications—insights that can lead to deeper mechanistic understanding when properly investigated.

What approaches help researchers distinguish between direct effects of ptdss2 manipulation and compensatory mechanisms in phospholipid metabolism?

Distinguishing direct effects of ptdss2 manipulation from compensatory responses represents a significant challenge in phospholipid metabolism research, requiring sophisticated experimental design and analytical approaches. The primary challenge stems from the biological redundancy built into phospholipid synthesis pathways, particularly the overlapping functions of ptdss1 and ptdss2 . When approaching this question, researchers should implement a multi-faceted strategy that captures both immediate consequences and adaptive responses across different time scales.

Temporal analysis provides the most straightforward approach for separating direct effects from compensatory mechanisms. Acute manipulations through techniques like chemical inhibition or inducible genetic systems can reveal immediate consequences before compensatory pathways activate. Researchers should conduct time-course analyses following ptdss2 manipulation, collecting samples at multiple time points (minutes, hours, days) to capture the sequential activation of direct and compensatory pathways. Comprehensive lipidomic profiling at these time points can reveal how phosphatidylserine levels and other phospholipids change dynamically.

Genetic approaches offer powerful tools for dissecting these pathways. Double knockout or knockdown experiments targeting both ptdss1 and ptdss2 can eliminate the primary compensatory mechanism, revealing phenotypes that might be masked in single gene manipulations . Similarly, genetic screens for synthetic lethality or enhancement with ptdss2 mutation can identify genes that become essential only when ptdss2 function is compromised, potentially revealing cryptic compensatory pathways.

At the molecular level, RNA-seq analysis comparing acute versus chronic ptdss2 inhibition can identify differentially expressed genes that represent compensatory responses . Pathway enrichment analysis can then highlight which cellular processes are most affected. Similarly, proteomic approaches focusing on changes in protein phosphorylation or other post-translational modifications can reveal rapid signaling events that occur before transcriptional responses, potentially distinguishing direct consequences from adaptive mechanisms.

Cellular compartment-specific analysis represents another important approach, as phospholipid composition varies significantly between organelles. Techniques such as subcellular fractionation followed by lipidomic analysis or imaging using organelle-specific phosphatidylserine probes can reveal whether direct effects or compensatory responses predominate in different cellular compartments. This is particularly relevant for ptdss2, as its subcellular localization may differ from that of ptdss1, potentially leading to compartment-specific vulnerabilities when it is manipulated.

How might zebrafish ptdss2 research contribute to understanding human diseases related to phospholipid metabolism disorders?

Zebrafish ptdss2 research offers remarkable potential for illuminating human diseases associated with phospholipid metabolism disorders due to several advantageous features of this model organism. The genetic and functional conservation of phospholipid synthesis pathways between zebrafish and humans provides a strong foundation for translational research. Specifically, the redundancy between PTDSS1 and PTDSS2 observed in mammals appears conserved in zebrafish , making it an excellent model for studying compensatory mechanisms relevant to human disease states where one enzyme is compromised.

Neurodevelopmental disorders represent one promising area for translation, as phosphatidylserine plays crucial roles in neuronal membrane function and signaling. Zebrafish embryos develop externally and remain transparent through early development, allowing real-time visualization of neuronal development when combined with transgenic reporters. Researchers investigating conditions such as Lenz-Majewski syndrome (caused by PTDSS1 mutations) could generate equivalent mutations in zebrafish ptdss1 while manipulating ptdss2 expression to identify potential compensatory mechanisms or therapeutic approaches.

Cancer research represents another promising translational direction, building on findings that PTDSS2 deletion creates cancer cell vulnerability to PTDSS1 inhibition . The zebrafish cancer model system, particularly with transparent casper mutants, allows visualization of tumor development in real-time when combined with fluorescent reporters. This enables high-throughput screening of compounds that might selectively target cancer cells with PTDSS2 deletions while sparing normal tissues. The intratumoral heterogeneity in PTDSS2 expression observed in human samples can be modeled in zebrafish to develop and test strategies for overcoming potential resistance mechanisms.

For successful translation to human applications, researchers should implement comparative approaches that explicitly validate findings across species. This might include complementation studies where human PTDSS enzymes are expressed in zebrafish mutants to assess functional conservation, or parallel studies in zebrafish and human cell lines to confirm that molecular mechanisms are conserved. Additionally, pharmacological agents developed based on zebrafish findings should be tested in mammalian systems before proceeding to clinical applications.

What technological advances might enhance our ability to study ptdss2 function and phosphatidylserine synthesis in zebrafish models?

Emerging technologies across multiple disciplines are poised to revolutionize our understanding of ptdss2 function and phosphatidylserine synthesis in zebrafish models. In the realm of genetic engineering, advances in CRISPR technologies offer unprecedented precision for manipulating the zebrafish genome. Base editing and prime editing systems now enable introduction of specific point mutations without double-strand breaks, allowing researchers to model subtle variants identified in human patients or to perform systematic structure-function studies of ptdss2. Additionally, CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems provide tunable, reversible control over ptdss2 expression without permanent genetic modification.

Advanced imaging technologies represent another frontier for phospholipid research in zebrafish. Super-resolution microscopy techniques such as STED, PALM, or STORM can now resolve subcellular structures below the diffraction limit, enabling visualization of phosphatidylserine distribution within organelles and membrane microdomains. When combined with genetically encoded biosensors for phosphatidylserine (such as GFP-LactC2, which binds specifically to phosphatidylserine), these approaches can reveal dynamic changes in phospholipid localization with unprecedented spatial and temporal resolution. Light-sheet microscopy offers complementary advantages for whole-organism imaging, allowing visualization of phosphatidylserine dynamics across entire zebrafish embryos with minimal phototoxicity.

Metabolic labeling approaches using bioorthogonal chemistry provide powerful tools for studying phospholipid synthesis dynamics. Azide or alkyne-modified serine analogs can be incorporated into phosphatidylserine by ptdss2 in vivo, followed by click chemistry-based detection or pulldown. This approach enables pulse-chase experiments to track newly synthesized phosphatidylserine through cellular compartments and metabolic pathways, distinguishing it from existing pools. Similarly, stable isotope labeling combined with mass spectrometry can reveal the kinetics of phosphatidylserine synthesis and turnover in different tissues and developmental stages.

Single-cell technologies represent perhaps the most transformative frontier for ptdss2 research. Single-cell RNA-seq can reveal cell type-specific expression patterns of ptdss2 and related enzymes, while single-cell proteomics and metabolomics are rapidly advancing toward the sensitivity required for phospholipid analysis. These approaches can capture cellular heterogeneity that might be masked in bulk tissue analyses, potentially revealing specialized roles for ptdss2 in specific cell types or developmental states.

How can integrative multi-omics approaches advance our understanding of ptdss2 function in complex developmental and disease contexts?

Integrative multi-omics approaches offer unprecedented opportunities to elucidate ptdss2 function within complex biological networks across development and disease states. The fundamental premise of multi-omics integration is that biological complexity emerges from interactions across multiple molecular layers—genome, transcriptome, proteome, lipidome, and metabolome—requiring coordinated analysis to fully understand system behavior. For ptdss2 research, this approach can reveal relationships between genetic variation, gene expression, protein activity, phospholipid metabolism, and phenotypic outcomes that would remain obscure when studying each level in isolation.

A comprehensive multi-omics experimental design should begin with careful coordination of sample collection to enable integrated analysis. Researchers should collect parallel samples from the same experimental subjects for genomic, transcriptomic, proteomic, and lipidomic analyses, ensuring that variation between samples represents biological rather than technical differences. For developmental studies, precise staging is critical, as phospholipid compositions change dramatically during zebrafish embryogenesis. Similarly, in disease models, temporal sampling should capture disease progression from initiation through advanced stages.

Data integration represents the central challenge of multi-omics approaches, requiring sophisticated computational methods. For ptdss2 research, network-based integration strategies are particularly valuable, as they can place ptdss2 within its functional context of interacting genes, proteins, and metabolites. Weighted gene co-expression network analysis (WGCNA) can identify modules of co-regulated genes that include ptdss2, potentially revealing novel functional associations. Similarly, multi-omics factor analysis (MOFA) can identify latent factors that explain variation across different data types, potentially revealing coordinated changes in transcripts, proteins, and lipids that constitute functional pathways.

When applying these approaches to disease contexts, such as cancer models with ptdss2 deletion , researchers should implement experimental designs that capture both tumor and microenvironmental components. Single-cell multi-omics technologies are particularly valuable in this context, as they can reveal cell type-specific responses to ptdss2 manipulation. For example, integrated single-cell transcriptomics and proteomics could reveal how cancer cells with ptdss2 deletion differ from neighboring wild-type cells, and how these differences influence interactions with immune cells in the tumor microenvironment.

Longitudinal designs add another dimension to multi-omics integration, enabling researchers to distinguish cause from consequence in complex biological processes. By collecting multi-omics data at multiple time points following ptdss2 manipulation, researchers can construct temporal networks that reveal the sequence of molecular events, helping distinguish primary effects from downstream consequences or compensatory responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.