Recombinant Danio rerio Post-GPI attachment to proteins factor 2 (pgap2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Post-GPI Attachment to Proteins Factor 2 (pgap2)

Recombinant Danio rerio pgap2 is a synthetically produced protein derived from zebrafish (Danio rerio) that mimics the function of the endogenous pgap2 protein. This protein plays a critical role in the lipid remodeling of glycosylphosphatidylinositol (GPI) anchors, a process essential for stabilizing GPI-anchored proteins (GPI-APs) in cellular membranes. The recombinant version is widely used in biochemical studies, ELISA assays, and structural analyses to investigate GPI anchor biosynthesis and its implications in disease .

Functional Role in GPI Anchor Biosynthesis

pgap2 facilitates the lipid remodeling of GPI anchors in the Golgi apparatus, replacing unsaturated fatty acids with saturated chains (e.g., stearic acid) to enhance membrane stability . This process is essential for:

  1. Lipid Raft Association: GPI-APs with saturated fatty acids partition into cholesterol-rich lipid rafts, enabling signaling and cellular adhesion .

  2. Cell Surface Retention: Defective pgap2 activity leads to secretion of GPI-APs due to impaired lipid remodeling .

  3. Disease Pathogenesis: Mutations in pgap2 are linked to congenital disorders of glycosylation (PGAP2-CDG), characterized by intellectual disability and elevated alkaline phosphatase .

Disease Modeling

  • PGAP2-CDG: Hypomorphic mutations (e.g., p.Tyr99Cys, p.Arg177Pro) reduce pgap2 activity, impairing GPI-AP surface expression in neurons and epithelial cells .

  • Phenotypic Expansion: Recent studies associate pgap2 variants with macrocephaly, digital anomalies, and hearing loss, broadening its clinical spectrum .

Clinical Relevance and Disease Association

PGAP2-CDG (hyperphosphatasia with intellectual disability syndrome 3) manifests due to:

  1. Reduced GPI-AP Stability: Impaired fatty acid remodeling leads to shedding of GPI-APs, disrupting cell signaling and adhesion .

  2. Elevated Alkaline Phosphatase: A hallmark biochemical marker linked to defective GPI anchor synthesis .

Disease FeatureMechanism
Intellectual DisabilityLoss of GPI-APs in neurons disrupts synaptic signaling and neurodevelopment
HyperphosphatasiaRelease of GPI-anchored alkaline phosphatase into circulation
MacrocephalyImpaired lipid raft formation affects cortical development

Comparative Analysis of pgap2 Across Organisms

OrganismKey FunctionExperimental Model
Homo sapiensFatty acid remodeling in GolgiCHO cell knockouts, patient cells
Danio rerioGPI-AP retention in zebrafish embryosRecombinant protein studies, ELISA
Chinese HamsterSurface expression of DAF/CD59Rescue experiments in pgap2-deficient cells

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure a specific tag, please inform us, and we will prioritize its development.
Synonyms
pgap2; frag1; zgc:101568; Post-GPI attachment to proteins factor 2; FGF receptor-activating protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
pgap2
Target Protein Sequence
MQQVPYGSVDRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNY LPSISAAISLTPERYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLA LSENVGLLLLTYVSSTETYSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSY WFKLRLFLFNGGCCVLAVYFYRRHNTYCEEGITHASRCVSIWWCCPTWPST
Uniprot No.

Target Background

Function
This protein is involved in the lipid remodeling steps of GPI-anchor maturation and is essential for the stable cell surface expression of GPI-anchored proteins.
Database Links
Protein Families
PGAP2 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is PGAP2 and what role does it play in zebrafish cellular biology?

PGAP2 (Post-GPI attachment to proteins factor 2) is a transmembrane protein involved in remodeling the glycosylphosphatidylinositol (GPI) anchor in the Golgi apparatus. In zebrafish, as in other organisms, PGAP2 catalyzes the addition of stearic acid to the lipid portion of the GPI anchor . This protein plays a critical role in the final stages of GPI-anchor modification. The zebrafish PGAP2 is also known as FGF receptor-activating protein 1 (FRAG1) .

Without functional PGAP2, cells lack stable surface expression of a variety of GPI-anchored proteins (GPI-APs), resulting in a functional GPI deficiency . This can lead to developmental abnormalities, as GPI-anchored proteins are crucial for numerous cellular processes, including signal transduction, cell adhesion, and immune function.

How conserved is PGAP2 function between zebrafish and mammals?

PGAP2's function appears to be highly conserved between zebrafish and mammals. In both systems, PGAP2 mediates the fatty acid remodeling of GPI anchors, specifically catalyzing the addition of stearic acid to the lipid portion . This conservation extends to the phenotypic consequences of PGAP2 deficiency.

In humans, autosomal recessive mutations in PGAP2 cause Hyperphosphatasia with Mental Retardation Syndrome 3 (HPMRS3), characterized by developmental delay, seizures, microcephaly, heart defects, and various neurocristopathies including Hirschsprung's disease, cleft lip, cleft palate, and facial dysmorphia . Similarly, zebrafish with compromised PGAP2 function demonstrate developmental abnormalities, suggesting that the protein's role in development is conserved across vertebrates.

What expression patterns does PGAP2 exhibit during zebrafish development?

Unlike some GPI biosynthesis genes that are ubiquitously expressed, PGAP2 shows tissue-specific and developmentally regulated expression patterns. Research has revealed that PGAP2 displays enriched expression in specific tissues during certain stages of development .

In zebrafish embryos, PGAP2 expression appears to be particularly pronounced in tissues that are most affected in GPI biosynthesis mutants, including the craniofacial complex, central nervous system, limb buds, and heart . This regionalized expression pattern suggests that PGAP2 may have tissue-specific requirements for anchoring GPI-APs critical to those tissues, or alternatively, these areas may be particularly "GPI-rich."

This pattern is consistent with observations in other model organisms. For example, PGAP2 expression in mice is enriched in the ganglion cell layer of the retina at E11.5 and E14.5, and by E16.5 shows expression in the salivary gland, epidermis, stomach, nasal conchae, myocardium, bronchi, kidney, uroepithelium, lung parenchyma, a specific layer of the cortex, and ear .

What expression systems are suitable for producing recombinant Danio rerio PGAP2?

Recombinant Danio rerio PGAP2 can be produced using various expression systems, each with distinct advantages depending on research requirements. Based on available information, suitable expression systems include:

  • E. coli expression system: Useful for producing large quantities of protein, though may lack appropriate post-translational modifications. This system is often used for structural studies or antibody production .

  • Yeast expression system: Provides eukaryotic post-translational modifications while maintaining relatively high yields. This can be valuable for functional studies requiring proper protein folding .

  • Baculovirus expression system: Offers improved eukaryotic post-translational modifications compared to yeast, suitable for functional studies requiring more native-like protein structure .

  • Mammalian cell expression system: Provides the most native-like post-translational modifications, which is critical for studying PGAP2's role in GPI-anchor remodeling. CHO (Chinese hamster ovary) cells have been successfully used for PGAP2 studies .

When selecting an expression system, consider the experimental goals: structural studies may prioritize quantity, while functional assays require properly folded and modified protein.

How can researchers verify the function of recombinant PGAP2 in experimental systems?

Functional verification of recombinant PGAP2 can be achieved through several complementary approaches:

  • Rescue experiments: Transfect PGAP2-deficient cell lines (such as PGAP2-deficient CHO cells) with recombinant PGAP2 and assess restoration of GPI-anchored protein expression. This approach has been successfully used to confirm the pathogenicity of PGAP2 mutations .

  • FLAER staining and flow cytometry: Fluorescein-labeled proaerolysin (FLAER) is a bacterial toxin conjugated to fluorescein that binds directly to the GPI anchor in the plasma membrane. Flow cytometry analysis using FLAER provides quantitative assessment of GPI-anchor expression on the cell surface . A comparison between wild-type cells and cells expressing recombinant PGAP2 can verify functional activity.

  • Surface expression analysis of specific GPI-APs: Examine the expression of known GPI-anchored proteins such as DAF (CD55) and CD59 through immunostaining and flow cytometry. Successful recovery of surface expression in PGAP2-deficient cells indicates functional recombinant PGAP2 .

  • Co-localization studies: Use immunocytochemistry with markers like wheat germ agglutinin (WGA) to assess proper trafficking of GPI-anchored proteins to the plasma membrane in cells expressing recombinant PGAP2 .

What technical challenges are associated with handling recombinant PGAP2 proteins?

Working with recombinant PGAP2 presents several technical challenges that researchers should consider:

  • Protein solubility: As a transmembrane protein, PGAP2 contains hydrophobic domains that can cause aggregation during expression and purification. This may require optimization of detergents or use of fusion tags to improve solubility.

  • Storage stability: Recombinant PGAP2 proteins require appropriate storage conditions to maintain activity. The recommended storage for commercially available recombinant PGAP2 is at -20°C, with long-term storage at -20°C or -80°C. Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing is not recommended .

  • Maintaining native conformation: As PGAP2 functions in the Golgi apparatus membrane, maintaining its native conformation during purification can be challenging. Reconstitution into appropriate lipid environments may be necessary for functional studies.

  • Purity requirements: High purity (>90%) is generally required for functional studies . Achieving this level of purity for a membrane protein can be technically demanding and may require multiple purification steps.

  • Glycerol content: Commercial preparations often contain glycerol for stability , which should be considered when designing experiments as it may affect certain assays.

What is the exact biochemical function of PGAP2 in the GPI anchor remodeling process?

PGAP2 catalyzes a specific step in the fatty acid remodeling of GPI anchors that occurs in the Golgi apparatus. After the GPI anchor is synthesized in the endoplasmic reticulum (ER) and transferred to proteins, it undergoes remodeling while being transported through the Golgi to the cell membrane .

Specifically, PGAP2 mediates the addition of stearic acid (C18:0) to the lipid portion of the GPI anchor . This fatty acid remodeling is crucial for the stable association of GPI-anchored proteins with the plasma membrane, particularly with lipid rafts, which are specialized membrane microdomains enriched in cholesterol and sphingolipids.

PGAP2 represents the final protein in the GPI biosynthesis pathway . In its absence, GPI-anchored proteins can still be synthesized and initially attached to the membrane, but they lack stable surface expression, leading to a functional GPI deficiency .

How does PGAP2 function differ from other proteins in the GPI biosynthesis pathway?

The GPI biosynthesis and remodeling process is extensive, requiring nearly 30 genes that function in different compartments of the cell . PGAP2's role can be distinguished from other proteins in the pathway in several key ways:

  • Cellular localization: While PIG proteins (Phosphatidylinositol Glycan Biosynthesis Class) function primarily in the ER for initial GPI biosynthesis, PGAP2 operates in the Golgi apparatus for remodeling of the already-synthesized GPI anchor .

  • Biochemical function: PGAP2 specifically catalyzes the addition of stearic acid to the lipid portion of the GPI anchor, which is a remodeling step rather than part of the initial biosynthesis .

  • Position in pathway: PGAP2 acts at the final stages of GPI-anchor modification, after the anchor has already been attached to proteins .

  • Expression pattern: Unlike some GPI biosynthesis genes that show ubiquitous expression, PGAP2 demonstrates tissue-specific enrichment patterns during development .

  • Phenotypic consequences: Mutations in different GPI biosynthesis genes result in varying phenotypic severities. PGAP2 deficiency causes an intermediate defect in GPI-AP membrane trafficking compared to deficiencies in earlier-acting genes like PIGA .

How can researchers quantitatively assess PGAP2 activity in zebrafish models?

Several experimental approaches can be employed to quantitatively assess PGAP2 activity in zebrafish models:

What approaches are most effective for generating PGAP2 mutants in zebrafish?

Several approaches can be employed to generate PGAP2 mutants in zebrafish, each with distinct advantages depending on research objectives:

  • CRISPR/Cas9 genome editing: This is currently the most efficient method for generating targeted mutations in zebrafish. For PGAP2, researchers can design guide RNAs targeting critical exons (particularly those encoding catalytic domains) and inject them along with Cas9 protein or mRNA into one-cell stage embryos. This approach allows for precise targeting and can generate frameshift mutations, deletions, or specific amino acid changes .

  • TILLING (Targeting Induced Local Lesions in Genomes): This reverse genetic approach involves random mutagenesis (typically using ENU, N-ethyl-N-nitrosourea) followed by screening for mutations in the gene of interest. When comprehensive annotation is lacking, TILLING can be an effective strategy for identifying mutations by sequencing PCR-amplified exons from thousands of mutagenized fish .

  • Morpholino knockdown: While not creating genetic mutations, antisense morpholino oligonucleotides can be used for transient knockdown of PGAP2 expression. This approach is useful for rapid assessment of phenotypes but may have off-target effects and is most reliable when complemented with genetic mutants.

  • ENU mutagenesis: Random chemical mutagenesis using ENU followed by forward genetic screens can identify phenotypes associated with PGAP2 dysfunction, such as developmental abnormalities in tissues where PGAP2 is highly expressed .

The choice of approach depends on research goals, with CRISPR/Cas9 offering the best combination of specificity, efficiency, and permanence for most applications.

How can researchers establish causality between PGAP2 mutations and observed phenotypes?

Establishing causality between PGAP2 mutations and observed phenotypes requires multiple lines of evidence:

  • Complementation testing: This is the gold standard for proving causality. By crossing two distinct mutant alleles of PGAP2 (from independent heterozygous carriers) and analyzing the F3 embryos that display the phenotype, researchers can confirm that the phenotype is caused by mutations in PGAP2 rather than linked mutations associated with either allele .

  • Rescue experiments: Introducing wild-type PGAP2 (via mRNA injection or transgenic expression) into mutant embryos should rescue the phenotype if the mutation in PGAP2 is causative. Similarly, in cell-based systems, transfection of PGAP2-deficient cells with wild-type PGAP2 should restore normal GPI-AP surface expression .

  • Structure-function analysis: Creating specific mutations in functional domains and assessing their effects can establish the relationship between protein function and phenotype. For example, site-directed mutagenesis to recreate human disease mutations (like p.Tyr99Cys or p.Arg177Pro) in zebrafish PGAP2 and testing their functional consequences provides evidence for causality .

  • Correlation with biochemical defects: Demonstration that the phenotype correlates with known biochemical functions of PGAP2, such as reduced FLAER staining or impaired surface expression of GPI-APs, strengthens the case for causality .

  • Phenocopy through targeted gene editing: Generating the same phenotype through multiple independent mutations in PGAP2 (especially using different techniques) provides strong evidence for causality.

What phenotyping strategies are most informative for characterizing PGAP2 mutants in zebrafish?

A multi-faceted phenotyping approach yields the most comprehensive characterization of PGAP2 mutants:

  • Morphological assessment: Detailed examination of tissues where PGAP2 is highly expressed, including craniofacial structures, heart, and CNS. This should include assessment at multiple developmental stages to capture time-dependent phenotypes .

  • Molecular phenotyping:

    • FLAER staining to quantify GPI anchor defects

    • Immunostaining for specific GPI-APs known to be dependent on PGAP2 for surface expression

    • Analysis of alkaline phosphatase levels, which are elevated in human PGAP2 mutations

  • Behavioral phenotyping: Given the neurological phenotypes associated with human PGAP2 mutations, behavioral assays (response to stimuli, swimming patterns, etc.) may reveal functional consequences not apparent from morphological analysis.

  • Tissue-specific analyses: Focused examination of tissues with enriched PGAP2 expression, using tissue-specific markers to assess developmental defects .

  • Multi-allelic phenotyping: Comparing phenotypes across different alleles with varying severity can establish genotype-phenotype correlations and identify potential hypomorphic versus null phenotypes .

  • Transcriptomic analysis: RNA-seq of mutant tissues can reveal downstream effects of PGAP2 deficiency and identify affected pathways.

  • Cellular phenotyping: Derivation of cell lines from mutant zebrafish allows detailed assessment of cellular phenotypes, including GPI-AP trafficking, membrane microdomain organization, and signaling.

How can zebrafish PGAP2 studies inform our understanding of human GPI anchor disorders?

Zebrafish PGAP2 studies provide valuable insights into human GPI anchor disorders through several mechanisms:

  • Modeling genetic variants: Human PGAP2 mutations associated with Hyperphosphatasia with Mental Retardation Syndrome 3 (HPMRS3) can be recreated in zebrafish to study their functional consequences. For example, human mutations like p.Tyr99Cys and p.Arg177Pro could be introduced into zebrafish PGAP2 to assess their effects on development and GPI-AP expression .

  • Tissue-specific requirements: The enriched expression of PGAP2 in specific tissues during zebrafish development helps explain why certain tissues (craniofacial complex, CNS, heart) are preferentially affected in human GPI anchor disorders . This tissue-specific vulnerability can be further investigated in zebrafish models.

  • Therapeutic testing: Zebrafish models offer a platform for high-throughput screening of potential therapeutics for GPI anchor disorders. Drawing from experience with other GPI deficiencies like Paroxysmal Nocturnal Hemoglobinuria (PNH), where complement inhibition has proven effective, similar approaches could be tested in zebrafish PGAP2 models .

  • Understanding variable penetrance: The variable penetrance of symptoms in human PGAP2 mutations can be investigated in zebrafish by studying the effects of genetic background and environmental factors on phenotypic expression.

  • Identification of critical GPI-APs: Zebrafish studies can identify which specific GPI-anchored proteins are most affected by PGAP2 deficiency and thus potentially responsible for particular aspects of the disease phenotype. For example, research has suggested FOLR1 (folate receptor 1) may be particularly relevant, as FOLR1-null mice show phenotypes similar to those observed in PGAP2-deficient models .

What experimental approaches can reveal tissue-specific functions of PGAP2 in zebrafish?

Elucidating tissue-specific functions of PGAP2 requires specialized experimental approaches:

  • Conditional knockout systems: Using Cre-loxP or similar systems to delete PGAP2 in specific tissues at defined developmental stages can reveal tissue-autonomous functions. This approach can distinguish between direct effects of PGAP2 deficiency in a tissue versus secondary effects from other tissues.

  • Tissue-specific rescue: In a global PGAP2 mutant background, expressing wild-type PGAP2 under tissue-specific promoters can determine which tissues require PGAP2 function to prevent specific phenotypes.

  • Lineage tracing combined with PGAP2 mutation: This approach can track the fate of cells lacking PGAP2 function during development to understand how PGAP2 deficiency affects cell behavior, migration, and differentiation in specific lineages.

  • Single-cell transcriptomics: Applying single-cell RNA-seq to wild-type and PGAP2-deficient zebrafish embryos can reveal cell type-specific responses to PGAP2 deficiency and identify particularly vulnerable cell populations.

  • In situ hybridization and immunohistochemistry: Detailed expression analysis at different developmental stages can map the dynamic expression of PGAP2 and correlate it with the expression of specific GPI-APs in the same tissues .

  • Tissue-specific proteomics: Mass spectrometry-based approaches to identify the GPI-anchored proteome in different tissues with and without PGAP2 function can reveal tissue-specific GPI-AP dependencies.

  • Live imaging of GPI-AP trafficking: Using fluorescently tagged GPI-APs in transparent zebrafish embryos allows for real-time visualization of protein trafficking in different tissues in the presence or absence of PGAP2 function.

What are potential applications of PGAP2 research beyond developmental biology?

PGAP2 research extends beyond developmental biology into several important domains:

  • Cancer biology: GPI-anchored proteins play roles in cancer progression, metastasis, and immune evasion. Understanding PGAP2's role in regulating GPI-AP expression could reveal novel therapeutic targets. Zebrafish xenograft models with manipulated PGAP2 expression could provide insights into how GPI-AP remodeling affects tumor behavior.

  • Immunology: Many GPI-anchored proteins have immune functions. The experience with PNH, where complement inhibition effectively manages disease caused by GPI deficiency, suggests potential immunological applications of PGAP2 research . Zebrafish models can explore how PGAP2 deficiency affects innate immune responses.

  • Neurobiology: Given the neurological phenotypes associated with human PGAP2 mutations and the enriched expression in neural tissues, PGAP2 research may provide insights into neuronal development, synaptic function, and neurological disorders.

  • Stem cell biology: GPI-anchored proteins play roles in stem cell maintenance and differentiation. Understanding how PGAP2 regulates these proteins could inform approaches for controlling stem cell behavior in regenerative medicine.

  • Drug delivery: GPI anchors provide a natural mechanism for membrane attachment. Engineered GPI-anchored proteins dependent on PGAP2 processing could serve as vehicles for delivering therapeutic agents to specific cell surfaces.

  • Evolutionary biology: Comparative studies of PGAP2 function across species can reveal evolutionary adaptations in GPI anchor remodeling and its relationship to organism complexity and tissue specialization.

  • Lipid raft biology: GPI-anchored proteins are enriched in lipid rafts, and PGAP2's role in fatty acid remodeling directly impacts raft association. Zebrafish models offer opportunities to study how PGAP2 influences membrane microdomain organization in vivo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.