Recombinant Danio rerio Presqualene diphosphate phosphatase (ppapdc2)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity and Substrate Specificity

PPAPDC2 exhibits diphosphate phosphatase activity with distinct substrate preferences:

SubstrateRelative ActivityOptimal Conditions
Presqualene diphosphate (PSDP)HighestpH 7.0–8.0, Mg²⁺-independent
Farnesyl diphosphate (FDP)ModeratepH 7.0–8.0
Phosphatidic acidLowpH 7.0–8.0

In vitro studies demonstrate that PPAPDC2 hydrolyzes PSDP to PSMP, a bioactive lipid involved in neutrophil signaling . It also dephosphorylates FDP and geranylgeranyl diphosphate (GGPP), intermediates in sterol synthesis and protein prenylation .

Functional Roles in Cellular Processes

  • Regulation of Rho GTPases: Overexpression of PPAPDC2 in mammalian cells reduces membrane-associated RhoA levels by 69%, impairing cytoskeletal organization and cell motility .

  • Sterol Metabolism: In yeast, PPAPDC2 overexpression depletes farnesyl diphosphate pools, causing sterol auxotrophy and growth defects .

  • Interconversion of Isoprenoids: PPAPDC2 modulates cellular levels of isoprenoid phosphates, as shown using synthetic isoprenol reporters like anilinogeraniol (AGOH) .

Research Applications

  • Isoprenoid Phosphate Metabolism: Used to study enzymatic pathways converting isoprenols to isoprenoid diphosphates .

  • Protein Prenylation Studies: PPAPDC2 overexpression reduces protein isoprenylation, aiding investigations into GTPase function .

  • Disease Models: Insights into dysregulated lipid signaling in immune disorders or cancers .

Comparative Analysis with Mammalian Homologs

While mammalian PPAPDC2 shares functional similarities with lipid phosphate phosphatases (LPPs), key differences include:

FeaturePPAPDC2Mammalian LPPs
Substrate PreferencePSDP > FDP > phospholipidsBroad phospholipid substrates
Cellular LocalizationEndoplasmic reticulum, nuclear envelopePlasma membrane
Physiological ImpactSevere growth defects upon overexpressionMild effects on cell proliferation

PPAPDC2’s unique orientation in membranes (cytoplasmic-facing catalytic domain) distinguishes it from LPPs .

Technical Considerations for Use

  • Handling: Lyophilized protein should be reconstituted gently to avoid aggregation .

  • Activity Assays: Use radiolabeled PSDP or mass spectrometry-based methods for quantitative analysis .

  • Controls: Include catalytically inactive mutants (e.g., site-directed mutants of the HxKxxxxD motif) to validate results .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
plpp6; ppapdc2; si:ch211-191d7.4; si:ch211-246k22.2; zgc:112181; Phospholipid phosphatase 6; Phosphatidic acid phosphatase type 2 domain-containing protein 2; Presqualene diphosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
plpp6
Target Protein Sequence
MPSPKARSGSGRSGSVPCPGGNGRYEFISLNRTPPSPVPPQLLQRQGSDPTTARLRASES PVRRRGSGSSNSSTGGGGQQLPEEDCMRLNPSFFGIALSSLLAIDLWLSKRLGVCACEDS SWGSVRPLMKLIEVSGHGIPWLAGAAYCLYKSDSPAGQEVMLNLLMALVLDVVLVGVLKA VVRRRRPAHNRMDMFATFSVDSYSFPSGHATRAAMCARFLLNHLVLAAPLRVLVLLWATI VGFSRVLLGRHNVTDVAFGFFMGYWQYNLVEMLWLSPVMLQSAIGQLH
Uniprot No.

Target Background

Function
This phosphatase dephosphorylates presqualene diphosphate (PSDP) into presqualene monophosphate (PSMP). PSDP is a bioactive lipid that rapidly converts to PSMP upon cell activation.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.