Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-A (rnf144aa)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
rnf144aa; si:ch211-276e8.1; Probable E3 ubiquitin-protein ligase RNF144A-A; RING finger protein 144A-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
rnf144aa
Target Protein Sequence
MTTARYRPTWDLALDPLVSCKLCLGEFPLEQMTTITQCQCVFCTMCLKQYVELLIKEGFE
TAISCPDSACPKRGHLQENEIECMVATEIMQRYRKLQFEKEVLLDPSRTWCPSSTCQAVC
QLKESDTVLPQLVRCSVCTLEFCSACKASWHPDQDCQENVPITSFLPGESSSFFKADDDD
APIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHS
RASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT
Uniprot No.
Target Background
Function
E3 ubiquitin-protein ligase that accepts ubiquitin from E2 ubiquitin-conjugating enzymes (UBE2L3 and UBE2L6) via a thioester linkage, subsequently transferring the ubiquitin to target substrates.
Database Links
Protein Families
RBR family, RNF144 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
