Recombinant Danio rerio Probable G-protein coupled receptor 173 (gpr173)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio GPR173

Recombinant Danio rerio GPR173 is a full-length, His-tagged protein (387 amino acids; UniProt ID: Q9I918) expressed in E. coli . It belongs to the Super Conserved Receptor Expressed in Brain (SREB) subfamily, specifically designated SREB3, which is highly conserved across vertebrates (98% amino acid identity between zebrafish and humans) .

PropertyDetails
SpeciesZebrafish (Danio rerio)
SourceE. coli expression system
TagN-terminal His tag
Molecular Weight~43 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Production and Quality Control

The recombinant protein is generated through codon-optimized E. coli expression, followed by affinity chromatography purification . Critical quality parameters include:

ParameterSpecification
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for stability
StabilityStable for 1 week at 4°C; long-term storage at -80°C
Functional AssaysValidated in GTPγS binding assays for constitutive activity

Signaling Mechanisms

GPR173 exhibits constitutive Gs-protein coupling, activating cAMP/protein kinase A pathways . Inverse agonists (e.g., compounds from the RIKEN NPDepo library) reduce basal activity, with IC₅₀ values as low as 8 μM .

Physiological Roles

  • Reproductive Regulation: Modulates GnRH and Kiss1 gene expression via CREB signaling .

  • Disease Associations:

    • Linked to systemic lupus erythematosus (SLE) via SNP rs13440883 .

    • Potential biomarker for neuroendocrine disorders .

Comparative Studies

SpeciesAmino Acid Identity with Zebrafish GPR173
Human98%
Mouse97%
Bovine89%
Source:

Challenges and Future Directions

  • Ligand Identification: Despite conserved structure, endogenous ligands remain unknown .

  • Therapeutic Potential: Targeting GPR173 may offer avenues for SLE and fertility treatments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
gpr173; sreb3; Probable G-protein coupled receptor 173; Super conserved receptor expressed in brain 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MANGNASSDGPGNPLAAVVSTTGGVMGGAPSSAVSTYVKLVLLGLIICISLVGNLVVSLL VLRDRALHKAPYYFLLDLCLADTIRSAVCFPFVLVSIKNGSAWTYSVLSCKVVAFMAVLF CFHAAFMLFCISVTRYMAIAHHRFYSKRMTFWTCVAVVCMVWTLSVAMAFPPVFDVGTYK FIREEDQCIFEHRYFKANDTLGFMLMLAVLILATHVVYMKLLLFEYKHRKMKPVQMVPAI SQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNLHNQNRRLLGMEEFKAEKQLGR MFYVITLFFLVLWSPYIVACYWRVFVKACTIPHRYLSTTVWMSFAQAGVNPIICFFLNKD LKKGLLAHLPPCCRTPPQLPREPYCVM
Uniprot No.

Target Background

Function
This receptor binds to the SMIM20 derived peptides Phoenixin-14 and Phoenixin-20. It facilitates the augmentation of gonadotropin-releasing hormone (GNRH) signaling by Phoenixin-14 and Phoenixin-20 in the hypothalamus and pituitary gland. In the ovary, it mediates the effects of Phoenixin-14 and Phoenixin-20 induced granulosa cell proliferation during follicular growth.
Database Links

KEGG: dre:57926

STRING: 7955.ENSDARP00000063004

UniGene: Dr.85372

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR173 and what protein family does it belong to?

GPR173 (also known as Super conserved receptor expressed in brain 3 or SREB3) is a G-protein coupled receptor belonging to the Class A (Rhodopsin) orphan receptors family, specifically within the Class A orphans GPR173 subfamily . This receptor is characterized by its seven-transmembrane domain structure typical of GPCRs, with specific structural features that distinguish it from other GPCRs. In Danio rerio (zebrafish), GPR173 is encoded by the gpr173 gene (also known as sreb3) and consists of 387 amino acids in its full-length form .

What expression systems are available for recombinant Danio rerio GPR173 production?

Multiple expression systems have been developed for producing recombinant GPR173, each with distinct advantages depending on research needs:

Expression SystemTags AvailableAdvantagesApplications
E. coliHisHigh yield, cost-effectiveStructural studies, antibody production
HEK-293 CellsHis, StrepProper folding, post-translational modificationsFunctional assays, protein-protein interaction studies
Cell-free protein synthesis (CFPS)StrepRapid production, membrane protein-friendlyStructural biology, high-throughput screening

E. coli-expressed Danio rerio GPR173 is available as a full-length protein (1-387 amino acids) with N-terminal His tag, typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

How can I validate the expression and purity of recombinant GPR173?

Validating recombinant GPR173 expression and purity requires complementary analytical techniques:

  • SDS-PAGE analysis: Confirms protein size (expected MW of ~43 kDa plus tag) and purity greater than 90% .

  • Western blotting: Using anti-His antibodies or specific anti-GPR173 antibodies to confirm identity. For His-tagged proteins, anti-tag ELISA can also be employed .

  • Analytical SEC (HPLC): Important for assessing protein homogeneity and oligomeric state. This technique helps detect aggregation and confirms proper folding .

  • Mass spectrometry: For precise molecular weight confirmation and identification of post-translational modifications.

  • Functional assays: To confirm that the recombinant protein maintains biological activity. For GPCRs, this often involves ligand binding assays or downstream signaling evaluation.

For zebrafish GPR173 expressed in E. coli, validation typically includes SDS-PAGE showing greater than 90% purity, with additional confirmation via immunological techniques using tag-specific antibodies .

What are the optimal storage and reconstitution conditions for preserving GPR173 activity?

Maintaining optimal storage and reconstitution conditions is critical for preserving GPR173 structural integrity and activity:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can cause protein denaturation

  • For long-term storage, aliquot reconstituted protein with 5-50% glycerol (final concentration) and store at -20°C/-80°C

Reconstitution protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 50% final concentration for stability

  • Create single-use aliquots to avoid freeze-thaw cycles

The protein is typically supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How does the sequence of Danio rerio GPR173 compare to mammalian orthologs?

Danio rerio GPR173 shares significant sequence homology with mammalian orthologs, particularly in the transmembrane regions and key functional motifs. When comparing the full-length 387-amino acid zebrafish sequence with human, mouse, and rat orthologs:

SpeciesSequence IdentityConserved DomainsKey Differences
Human~65-70%TM domains, DRY motifExtended N-terminus in human
Mouse~64-68%TM domains, NPxxY motifVariation in ECL2 region
Rat~64-68%TM domains, ligand binding pocketDifferences in ICL3 length

The highest conservation is observed in the transmembrane domains and motifs critical for G-protein coupling, suggesting functional conservation across species. This level of homology makes zebrafish GPR173 a valuable model for studying the fundamental biology of this receptor family .

What experimental applications is recombinant GPR173 suitable for?

Recombinant Danio rerio GPR173 can be utilized in multiple experimental applications:

  • ELISA: For protein-protein interaction studies, antibody screening, and quantitative analysis .

  • Western Blot (WB): For detection and quantification of GPR173 in tissue or cell lysates, often using anti-tag antibodies when working with recombinant protein .

  • SDS-PAGE: For purity assessment and molecular weight confirmation .

  • Analytical SEC (HPLC): For analyzing protein homogeneity, oligomeric state, and stability under different buffer conditions .

  • Structural biology: Including X-ray crystallography or cryo-EM for determining 3D structure, particularly important as GPR173 is an orphan receptor.

  • Ligand screening: Using techniques such as surface plasmon resonance (SPR) or differential scanning fluorimetry (DSF) to identify potential binding partners.

  • Antibody production: As an immunogen for generating specific antibodies against GPR173.

  • Pull-down assays: Using the His tag to identify potential interacting partners from cell lysates.

The appropriate application depends on the experimental goals and the specific expression system used to produce the recombinant protein .

What strategies can help optimize the functional expression of membrane proteins like GPR173?

Optimizing the functional expression of membrane proteins like GPR173 requires addressing several challenges:

  • Expression system selection:

    • For functional studies, mammalian expression systems like HEK-293 cells provide proper folding and post-translational modifications

    • For structural studies requiring higher yields, E. coli or cell-free protein synthesis may be preferred

  • Construct design optimization:

    • Consider truncating flexible regions while preserving functional domains

    • Add fusion partners to improve stability and expression (e.g., SUMO, MBP)

    • Optimize codon usage for the expression host

  • Solubilization strategies:

    • Screen detergents or lipid nanodisc formulations for optimal extraction

    • Consider bicelles or nanodiscs for maintaining native-like membrane environment

    • Test different detergent concentrations and combinations

  • Purification enhancement:

    • Implement two-step purification strategies (e.g., IMAC followed by size exclusion)

    • Optimize buffer conditions including pH, salt concentration, and stabilizing additives

    • Consider adding ligands or antagonists during purification to stabilize conformation

  • Stability improvement:

    • Add stabilizing agents such as cholesterol or specific lipids

    • Screen thermal stabilizing mutations

    • Include glycerol (5-50%) or trehalose (6%) in storage buffers

These approaches should be systematically tested to determine optimal conditions for your specific experimental requirements.

What analytical methods can be used to assess GPR173 functional activity?

Assessing the functional activity of an orphan receptor like GPR173 requires creative approaches in the absence of known ligands:

  • G-protein coupling assays:

    • BRET/FRET-based methods to detect conformational changes

    • [³⁵S]GTPγS binding assays to measure G-protein activation

    • Calcium mobilization assays if Gq-coupling is suspected

  • Signaling pathway analysis:

    • cAMP accumulation assays for Gs/Gi coupling assessment

    • IP3 production for Gq pathway activation

    • ERK1/2 phosphorylation for MAPK pathway engagement

    • β-arrestin recruitment assays for internalization

  • Ligand discovery approaches:

    • Reverse pharmacology screening using tissue extracts

    • Computational prediction of potential ligands based on structural homology

    • Yeast-based reporter systems for high-throughput screening

  • Conformational stability assessment:

    • Thermal shift assays to detect ligand-induced stabilization

    • Limited proteolysis to identify protected conformations

    • Hydrogen-deuterium exchange mass spectrometry

  • Cell-based functional readouts:

    • Internalization assays using fluorescently-tagged receptors

    • Transcriptional reporter assays linked to potential downstream pathways

    • Phenotypic screens in zebrafish models with genetic manipulations of gpr173

These methods can be combined in a systematic approach to characterize GPR173 function even in the absence of identified ligands.

What are common challenges in working with recombinant GPCRs like GPR173?

Researchers face several technical challenges when working with recombinant GPCRs:

  • Low expression yields: GPCRs often express at lower levels than soluble proteins.

    • Solution: Optimize codons, use specialized expression vectors, or explore insect cell or mammalian expression systems that may improve yields .

  • Protein instability: GPCRs can be unstable outside their native membrane environment.

    • Solution: Include stabilizing agents like glycerol (5-50%) and trehalose (6%) in buffers; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for short durations .

  • Improper folding: Incorrect folding can occur, particularly in prokaryotic expression systems.

    • Solution: Consider expression in HEK-293 cells or cell-free protein synthesis systems that better support GPCR folding .

  • Aggregation issues: GPCRs may aggregate during purification or storage.

    • Solution: Optimize detergent types and concentrations; monitor protein homogeneity using analytical SEC (HPLC) .

  • Functional validation: As an orphan receptor, confirming functional activity of GPR173 is challenging.

    • Solution: Use indirect assays such as conformational stability tests or G-protein coupling assays.

  • Post-translational modification differences: Expression system may not recapitulate natural PTMs.

    • Solution: Choose mammalian expression systems for studies where PTMs are critical.

Understanding these challenges and implementing appropriate solutions can significantly improve experimental outcomes when working with recombinant GPR173.

How can I develop a deorphanization strategy for GPR173?

Developing a systematic deorphanization strategy for GPR173 requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Phylogenetic comparison with related GPCRs whose ligands are known

    • Structural modeling to predict potential ligand binding pockets

    • Gene expression correlation analysis to identify co-expressed genes that might encode ligands

  • Tissue-based screening:

    • Prepare tissue extracts from brain regions where GPR173 is highly expressed

    • Fractionate extracts and test for receptor activation

    • Focus on zebrafish brain regions for compatibility with the Danio rerio receptor

  • Candidate-based approaches:

    • Test peptides expressed in regions matching receptor expression

    • Screen small molecule libraries based on structural predictions

    • Evaluate lipids and other signaling molecules that activate related orphan receptors

  • Functional readout optimization:

    • Develop multiple assay formats (calcium mobilization, cAMP, β-arrestin, etc.)

    • Create chimeric G-proteins to enhance coupling efficiency

    • Establish reporter cell lines with amplified signal detection systems

  • Cross-species comparison:

    • Test whether ligands of related receptors in other species might activate GPR173

    • Evaluate conservation of binding pocket residues across species

    • Consider evolutionary conserved signaling pathways

This comprehensive approach increases the likelihood of identifying the endogenous ligand(s) for GPR173 and understanding its physiological function.

What are emerging approaches for studying orphan GPCRs like GPR173?

Several cutting-edge approaches are advancing our understanding of orphan GPCRs:

  • Structural biology breakthroughs:

    • Cryo-EM techniques allow structure determination with smaller protein quantities

    • Computational approaches like AlphaFold2 can predict structures with increasing accuracy

    • Fragment-based screening using crystallography to identify binding pockets

  • Single-cell technologies:

    • Single-cell RNA-seq to identify co-expression patterns with potential ligands

    • Single-cell proteomics to map receptor expression in specific cell populations

    • Spatial transcriptomics to visualize receptor expression in tissue context

  • CRISPR-based functional genomics:

    • Genome-wide screens to identify genes affecting receptor signaling

    • Precise genetic manipulation in zebrafish models to study gpr173 function in vivo

    • Base editing to introduce specific mutations for structure-function analysis

  • Advanced biosensors:

    • BRET/FRET-based conformational sensors with improved sensitivity

    • Engineered nanobodies as conformational biosensors

    • Development of GPR173-specific biosensors for real-time activation monitoring

  • Multi-omics integration:

    • Combining proteomics, metabolomics, and transcriptomics to identify signaling networks

    • Systems biology approaches to place GPR173 in broader signaling contexts

    • Machine learning to predict ligands from multi-dimensional data

These emerging approaches offer new opportunities to understand GPR173 biology beyond traditional deorphanization strategies.

How can comparative studies between zebrafish and mammalian GPR173 advance our understanding?

Comparative studies between zebrafish and mammalian GPR173 provide valuable insights:

  • Evolutionary conservation analysis:

    • Identifying highly conserved residues suggests functional importance

    • Diversified regions may indicate species-specific adaptations

    • Molecular clock analysis to understand evolutionary pressure on receptor function

  • Developmental biology advantages:

    • Zebrafish embryo transparency enables real-time imaging of receptor expression

    • Rapid development allows studying GPR173 function across developmental stages

    • Easy genetic manipulation facilitates functional studies in vivo

  • Physiological role exploration:

    • Comparison of expression patterns between species suggests conserved functions

    • Behavioral studies in zebrafish models with gpr173 mutations

    • Pharmacological cross-reactivity testing between species variants

  • Translational research opportunities:

    • Zebrafish models for high-throughput drug screening targeting GPR173

    • Validation of findings in mammalian systems to establish clinical relevance

    • Development of transgenic reporter lines for pathway visualization

  • Data integration framework:

    • Correlation of structural differences with functional divergence

    • Mapping sequence variations to phenotypic differences across species

    • Building predictive models for ligand specificity based on interspecies comparison

These comparative approaches can accelerate understanding of GPR173 biology and potentially identify conserved ligands and signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.