Recombinant Danio rerio Probable lipid phosphate phosphatase PPAPDC3 (ppapdc3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene nomenclature:

  • Primary gene name: ppapdc3

  • Alternative identifiers: plpp7, zgc:77336, im:7142624

Protein features:

  • UniProt ID: Q6P0E8

  • Sequence length: 287 amino acids

  • Catalytic activity: Probable lipid phosphate phosphatase (EC 3.1.3.-)

  • Structural domains: Contains conserved phosphatase type 2 domains

Recombinant production:

FeatureDetail
Host systemsE. coli, yeast, baculovirus, or mammalian cell lines
Purity≥85% (verified by SDS-PAGE)
TaggingN-terminal His tag (optional, depending on construct)
Storage-20°C in Tris-based buffer with 50% glycerol; avoid freeze-thaw cycles

Functional Insights

Biological roles:

  • Modulates phosphatidic acid (PA) and sphingolipid metabolism, critical for triglyceride synthesis and cellular signaling .

  • In murine studies, orthologs (e.g., LPP3/Plpp3) regulate diet-induced sphingomyelin accumulation and glucose tolerance, suggesting conserved metabolic functions .

Key enzymatic activities:

  • Dephosphorylates PA to diacylglycerol (DG), a precursor for phospholipids .

  • Processes sphingosine 1-phosphate (S1P), influencing lipid-mediated insulin signaling .

Research Applications

Experimental uses:

  • Lipidomics: Quantifying sphingolipid and glycerophospholipid species via HPLC-ESI tandem mass spectrometry .

  • Protein interaction studies: Investigating compartmentalized phosphatase activity in adipocytes .

  • Structural biology: Analyzing catalytic mechanisms using recombinant mutants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
plpp7; ppapdc3; zgc:77336; Inactive phospholipid phosphatase 7; Phosphatidic acid phosphatase type 2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
plpp7
Target Protein Sequence
MPANQTRSRARERNNVLNRPEFMSLNQPIKSGGGGGGGESRGTARRPSQRQQQNQQQQGD NPQPENNKDKKELPEEDCMQLNPSFKGIAMNSLLAIDICMSKRLGVCAHPSSSWGSVRSM VKLLALTGHGIPWVFGTIVCLMRSNTLAGQEVLVNLLLALLLDVMTVSGMQKLVKRKGPW EMPPGFFDYLAMDIYSFPAAHASRAVMVSKFLLAHLVLAVPLRILLVLWAILVGISRVLL GRHHLTDVGCGFALGFLHYSLVEMVWLSSNTCQTLISIGTFNWSPLY
Uniprot No.

Target Background

Function

This protein functions as a negative regulator of myoblast differentiation, partly through its effects on mTOR signaling. It exhibits no detectable enzymatic activity.

Database Links

KEGG: dre:402958

UniGene: Dr.160149

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Nucleus envelope. Endoplasmic reticulum membrane. Membrane; Multi-pass membrane protein.

Q&A

Why is zebrafish an appropriate model for studying PPAPDC3 function?

Zebrafish (Danio rerio) represents an excellent model for studying PPAPDC3 function for several methodological reasons:

  • Genetic homology: Approximately 70% of human genes have orthologs in zebrafish, making it an appropriate model for studying conserved proteins like PPAPDC3 .

  • Developmental accessibility: Zebrafish embryos develop externally and are transparent, allowing for direct observation of developmental processes potentially affected by PPAPDC3 activity.

  • Established model organism: Zebrafish is the second most used animal model in research, with well-established genetic manipulation techniques and extensive literature support .

  • Pattern formation studies: Zebrafish are particularly valuable for studying how genes like PPAPDC3 might influence developmental patterning and cell signaling pathways .

What are the optimal storage and reconstitution protocols for Recombinant PPAPDC3?

ParameterRecommended Protocol
Storage Temperature-20°C to -80°C upon receipt
AliquotingNecessary for multiple use to avoid freeze-thaw cycles
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Reconstitution1. Briefly centrifuge vial before opening
2. Reconstitute in deionized sterile water to 0.1-1.0 mg/mL
3. Add glycerol to 5-50% final concentration (50% recommended)
Working StorageWorking aliquots can be stored at 4°C for up to one week
Freeze-ThawAvoid repeated freeze-thaw cycles

These storage recommendations ensure maximum stability and activity of the recombinant protein for experimental use .

What techniques are most effective for analyzing PPAPDC3 interaction networks in zebrafish?

To effectively analyze PPAPDC3 interaction networks in zebrafish, researchers should employ a multi-faceted approach:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using anti-His antibodies against the recombinant His-tagged PPAPDC3

    • Proximity labeling techniques such as BioID or APEX in zebrafish cells

    • Yeast two-hybrid screening using PPAPDC3 as bait

  • Transcriptomic analysis:

    • RNA-seq of PPAPDC3 morphants or mutants to identify genes with altered expression

    • Single-cell RNA-seq to map cell-specific responses to PPAPDC3 modulation

  • Subcellular localization:

    • Immunofluorescence microscopy using antibodies against PPAPDC3 or the His tag

    • Generation of fluorescent protein fusions for live imaging studies

  • Network analysis:

    • Integration of interaction data with existing zebrafish interactome databases

    • Pathway enrichment analysis of differentially expressed genes in PPAPDC3-deficient models

  • Cross-species comparison:

    • Overlay of PPAPDC3 interactome data with mammalian ortholog networks to identify conserved interaction modules

These methodological approaches would provide a comprehensive view of PPAPDC3's functional interactions within zebrafish developmental and physiological contexts.

How can topological data analysis be applied to study potential roles of PPAPDC3 in zebrafish pattern formation?

Topological data analysis (TDA) offers powerful tools for quantifying complex biological patterns, which can be valuable for studying potential roles of PPAPDC3 in zebrafish pattern formation:

This methodological approach allows for rigorous quantitative analysis of how PPAPDC3 might influence pattern formation processes, moving beyond qualitative visual assessment to precise mathematical characterization of phenotypic effects.

What are the optimal experimental controls for studies involving Recombinant PPAPDC3?

Robust experimental design for studies involving Recombinant PPAPDC3 requires comprehensive controls:

Control TypeImplementationPurpose
Negative Controls1. Buffer-only treatments
2. Irrelevant His-tagged protein
3. Heat-inactivated PPAPDC3
4. Empty vector expression
Establish baseline and control for non-specific effects of the protein preparation or tag
Positive Controls1. Known lipid phosphate phosphatase
2. Established modulators of pathways being studied
Validate assay functionality and provide reference points for activity comparisons
Dosage ControlsSerial dilutions of recombinant PPAPDC3Establish dose-response relationships and determine optimal concentrations
Temporal ControlsTime-course experimentsDetermine optimal time points for observing PPAPDC3 effects
Specificity Controls1. PPAPDC3 with mutated catalytic site
2. Domain-specific mutations
3. PPAPDC3 without His tag
Distinguish between enzymatic activity effects and structural/binding effects
Technical Controls1. Multiple biological replicates
2. Different protein production batches
3. Alternative recombinant expression systems
Control for batch effects and system-specific artifacts

These methodological controls ensure that observed effects can be reliably attributed to PPAPDC3 activity rather than experimental artifacts or non-specific interactions.

What are the considerations for designing CRISPR/Cas9 knockout studies of PPAPDC3 in zebrafish?

When designing CRISPR/Cas9 knockout studies of PPAPDC3 in zebrafish, researchers should consider the following methodological aspects:

  • Guide RNA (gRNA) design:

    • Target early exons of PPAPDC3 to ensure complete loss of function

    • Design multiple gRNAs targeting different regions of the gene

    • Check for off-target effects using zebrafish genome databases

    • Consider conserved domains when selecting target sites

  • Delivery methods:

    • Microinjection of Cas9 protein and gRNA into one-cell stage embryos

    • Optimization of Cas9:gRNA ratios to maximize editing efficiency

    • Consider using Cas9 mRNA vs. protein based on experimental requirements

  • Validation strategies:

    • T7 endonuclease assay or high-resolution melt analysis for initial screening

    • Sequencing of targeted regions to confirm mutations

    • Western blotting to verify absence of PPAPDC3 protein expression

    • RT-qPCR to assess potential compensatory expression of related genes

  • Phenotypic analysis:

    • Comprehensive developmental assessment from embryo to adult stages

    • Special focus on tissues with known PPAPDC3 expression

    • Quantitative methods for pattern analysis if visible phenotypes emerge

  • Functional rescue:

    • Reintroduction of recombinant PPAPDC3 protein to verify phenotype specificity

    • mRNA rescue to distinguish between genetic compensation and direct effects

  • F0 vs. stable line considerations:

    • F0 mosaic mutants for rapid initial screening

    • Establishment of stable F2 lines for detailed phenotypic studies

This methodological framework ensures rigorous genetic manipulation and comprehensive phenotypic assessment of PPAPDC3 function in zebrafish.

How should enzyme activity assays be optimized for studying PPAPDC3 phosphatase function?

Optimizing enzyme activity assays for PPAPDC3 phosphatase function requires careful consideration of multiple parameters:

  • Substrate selection and preparation:

    • Test multiple potential lipid substrates including phosphatidic acid, lysophosphatidic acid, and sphingosine-1-phosphate

    • Use both natural and fluorescently/radioactively labeled substrates

    • Consider substrate solubility and presentation (micelles, liposomes, supported bilayers)

  • Reaction conditions optimization:

    • pH range testing (typically 6.0-8.0 for phosphatases)

    • Divalent cation requirements (Mg²⁺, Mn²⁺, Ca²⁺)

    • Temperature optimization (25-37°C)

    • Buffer composition screening

    • Detergent effects assessment

  • Kinetic parameter determination:

    • Establish linear range of the assay

    • Determine Km and Vmax for identified substrates

    • Calculate specific activity of the recombinant preparation

  • Activity detection methods:

    • Malachite green assay for released phosphate

    • Coupled enzyme assays

    • Mass spectrometry for direct product detection

    • Fluorescence-based real-time assays for continuous monitoring

  • Inhibition and activation studies:

    • Test known lipid phosphatase inhibitors

    • Screen for specific PPAPDC3 inhibitors

    • Examine effects of potential physiological regulators

  • Comparative analysis:

    • Parallel testing with related phosphatases

    • Comparison with mammalian orthologs

These methodological considerations ensure development of robust and specific assays for characterizing PPAPDC3 enzymatic activity, providing a foundation for understanding its biochemical function.

What are the common challenges in PPAPDC3 expression studies and how can they be addressed?

Researchers working with PPAPDC3 expression systems may encounter several challenges that require specific troubleshooting approaches:

  • Low protein yield from recombinant expression:

    • Optimize codon usage for E. coli expression

    • Test multiple expression strains (BL21, Rosetta, etc.)

    • Vary induction conditions (temperature, IPTG concentration, duration)

    • Consider using a solubility-enhancing fusion tag in addition to the His tag

    • Try alternative expression systems (insect cells, mammalian cells)

  • Protein insolubility/aggregation:

    • Add detergents or mild solubilizers to extraction buffers

    • Express protein at lower temperatures (16-18°C)

    • Co-express with molecular chaperones

    • Consider refolding protocols if inclusion bodies form

  • Loss of enzymatic activity:

    • Add reducing agents to prevent oxidation of cysteine residues

    • Include glycerol in storage buffers to enhance stability

    • Test activity immediately after purification

    • Minimize freeze-thaw cycles as recommended in storage protocols

  • Inconsistent activity measurements:

    • Standardize protein quantification methods

    • Use internal controls in each assay

    • Prepare fresh substrate solutions for each experiment

    • Ensure consistent buffer and salt conditions

  • Non-specific binding in interaction studies:

    • Optimize washing stringency in pull-down experiments

    • Include competing proteins (BSA) to reduce non-specific interactions

    • Use appropriate negative controls for each experiment

These troubleshooting approaches help address common technical challenges in PPAPDC3 research, improving experimental reproducibility and data reliability.

How should contradictory results in PPAPDC3 functional studies be addressed methodologically?

When facing contradictory results in PPAPDC3 functional studies, a systematic methodological approach should be employed:

  • Technical validation:

    • Verify protein identity by mass spectrometry or N-terminal sequencing

    • Confirm activity of recombinant protein preparations

    • Assess batch-to-batch variation in protein preparations

    • Validate antibody specificity through appropriate controls

  • Experimental design reassessment:

    • Evaluate differences in experimental conditions between contradictory studies

    • Systematically vary key parameters to identify sources of variability

    • Design experiments that directly address contradictions

  • Biological context considerations:

    • Examine developmental stage/timing differences

    • Consider genetic background variations in zebrafish lines

    • Evaluate potential compensatory mechanisms

    • Assess tissue-specific effects that might explain contradictions

  • Multi-method verification:

    • Apply complementary techniques to address the same question

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both gain-of-function and loss-of-function approaches

  • Statistical robustness:

    • Increase sample sizes to improve statistical power

    • Apply appropriate statistical tests for data analysis

    • Consider Bayesian approaches for contradictory data sets

    • Perform meta-analysis when multiple data sets are available

  • Collaborative resolution:

    • Engage with laboratories reporting contradictory results

    • Exchange materials (constructs, antibodies, fish lines) to exclude technical variables

    • Design joint experiments with standardized protocols

What statistical and bioinformatic approaches are most appropriate for analyzing PPAPDC3 experimental data?

For robust analysis of PPAPDC3 experimental data, researchers should employ the following statistical and bioinformatic approaches:

  • For expression pattern analysis:

    • Gene Ontology (GO) enrichment analysis to identify biological processes associated with PPAPDC3

    • Co-expression network analysis to identify genes with similar expression patterns

    • Hierarchical clustering of expression data across developmental stages

    • Principal Component Analysis (PCA) to identify major sources of variation

  • For phenotypic data analysis:

    • Appropriate parametric or non-parametric tests based on data distribution

    • Multiple testing correction (Bonferroni, FDR) when analyzing multiple phenotypes

    • Regression models for quantitative trait analysis

    • Topological data analysis for pattern quantification as described in research literature

  • For imaging data:

    • Automated image analysis workflows for unbiased quantification

    • Machine learning approaches for pattern classification

    • Advanced statistical methods that capture both local and global pattern attributes

  • For enzyme kinetics:

    • Non-linear regression for determining enzyme kinetic parameters

    • Statistical comparison of kinetic parameters between conditions

    • Bootstrap methods for estimating confidence intervals

  • For comparative genomics:

    • Sequence alignment tools for comparing PPAPDC3 orthologs

    • Phylogenetic analysis to understand evolutionary relationships

    • Structural prediction and comparison between species

  • Integrated analysis approaches:

    • Multi-omics data integration (transcriptomics, proteomics, lipidomics)

    • Systems biology modeling of pathways involving PPAPDC3

    • Meta-analysis methods for synthesizing results across studies

These methodological approaches ensure rigorous quantitative analysis of PPAPDC3-related experimental data, facilitating deeper insights into its biological functions and mechanisms.

What emerging technologies could advance our understanding of PPAPDC3 function in zebrafish?

Several cutting-edge technologies offer promising avenues for advancing PPAPDC3 research:

  • Single-cell multi-omics:

    • Single-cell RNA-seq to map PPAPDC3 expression at cellular resolution

    • Single-cell ATAC-seq to understand regulatory mechanisms

    • Spatial transcriptomics to correlate PPAPDC3 expression with anatomical locations

    • Integration of multiple single-cell data types for comprehensive analysis

  • Advanced genome editing:

    • Prime editing for precise PPAPDC3 modifications without double-strand breaks

    • Inducible CRISPR systems for temporal control of PPAPDC3 disruption

    • Base editing for introducing specific mutations to study structure-function relationships

    • CRISPR screening approaches to identify genetic interactions

  • Advanced imaging technologies:

    • Light sheet microscopy for whole-organism imaging of PPAPDC3 activity

    • Super-resolution microscopy for subcellular localization studies

    • Biosensor development for real-time monitoring of PPAPDC3 activity in vivo

    • Automated high-content imaging for phenotypic screening

  • In silico approaches:

    • Molecular dynamics simulations of PPAPDC3 structure and substrate interactions

    • Deep learning for pattern analysis and phenotype prediction

    • Network modeling of PPAPDC3 signaling pathways

  • Organoid and ex vivo systems:

    • Zebrafish-derived organoids for studying PPAPDC3 in simplified systems

    • Ex vivo explant cultures for manipulating PPAPDC3 in specific tissues

These emerging technologies could significantly enhance our understanding of PPAPDC3 biology by providing unprecedented resolution, precision, and throughput in experimental approaches.

How can translational research benefit from studies of zebrafish PPAPDC3?

Translational research can leverage zebrafish PPAPDC3 studies in several key ways:

  • Disease modeling:

    • Human genetic disorders linked to PPAPDC3 orthologs can be modeled in zebrafish

    • High-throughput screening of potential therapeutic compounds targeting phospholipid signaling pathways

    • Validation of genetic variants of unknown significance identified in human patients

  • Drug discovery applications:

    • Structure-based drug design targeting PPAPDC3 or related phosphatases

    • Phenotypic screening using PPAPDC3 mutant zebrafish

    • Toxicity assessment of compounds affecting lipid phosphatase pathways

  • Comparative biology insights:

    • Cross-species validation of phosphatase functions between zebrafish and mammals

    • Identification of conserved regulatory mechanisms with potential therapeutic relevance

    • Understanding evolutionary aspects of lipid signaling that inform human biology

  • Methodological advances:

    • Development of phosphatase assays that can be translated to clinical diagnostics

    • Biomarker identification related to lipid phosphatase activity

    • Novel analytical approaches for pattern quantification with medical imaging applications

This translational perspective helps bridge the gap between basic zebrafish PPAPDC3 research and potential clinical applications, highlighting the value of this model system in biomedical research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.