Recombinant Danio rerio Probable polyprenol reductase (srd5a3)

Shipped with Ice Packs
In Stock

Description

Biological Function

SRD5A3 is a bifunctional enzyme with roles in:

  • Dolichol Biosynthesis: Converts polyprenol to dolichol, a lipid carrier required for assembling glycan precursors in N-linked glycosylation .

  • Protein Glycosylation: Dolichol phosphate serves as a scaffold for oligosaccharide chain synthesis, which is transferred to nascent proteins .

In zebrafish, SRD5A3 deficiency disrupts glycosylation pathways, mirroring human congenital disorders like SRD5A3-CDG, which causes neurological and developmental defects .

Disease Modeling

  • Zebrafish Knockout Models: Generated via CRISPR/Cas9 to study SRD5A3-CDG pathology. These models exhibit metabolic disturbances in the mevalonate pathway and abnormal dolichol levels .

  • Functional Rescue Studies: Human SRD5A3 can complement yeast DFG10 mutants, demonstrating evolutionary conservation .

Biochemical Studies

  • Enzyme Kinetics: Used to characterize NADPH-dependent reductase activity and substrate specificity .

  • Structural Analysis: Aids in mapping catalytic residues critical for polyprenol reduction .

Therapeutic Development

  • Gene Therapy Testing: Cerebellum-specific mouse SRD5A3 knockouts inform preclinical trials for CDGs .

  • Metabolic Pathway Profiling: Patient-derived fibroblasts and zebrafish models identify biomarkers like elevated polyprenol .

Key Research Findings

  • Evolutionary Conservation: Zebrafish SRD5A3 shares 65% sequence identity with human SRD5A3, retaining critical reductase domains .

  • Dolichol Dependency: Depletion in zebrafish models reduces LLO (lipid-linked oligosaccharide) levels, impairing glycosylation .

  • Compensatory Pathways: Residual dolichol in SRD5A3-deficient cells suggests alternate biosynthesis routes, a focus of ongoing research .

Challenges and Future Directions

  • Structural Resolution: No crystal structure exists for zebrafish SRD5A3, limiting mechanistic insights .

  • In Vivo Dynamics: Tissue-specific roles in zebrafish development remain underexplored .

  • Therapeutic Screening: High-throughput assays using recombinant SRD5A3 could identify small-molecule correctors for CDGs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your product.
Synonyms
srd5a3; si:ch211-278f21.3; Polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Steroid 5-alpha-reductase 3; S5AR 3; SR type 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
srd5a3
Target Protein Sequence
MFHILSIVNIIWLLLALCFGAAFCLNKFSVKLPNRVEHVFQDFIRYGKTKENIKRASWQL VFDLSKRYFYHFYVVSVMWNGLLLLFSIRSVVMSEAFPDWIIDVLGSLTGRSRGAWNEIH LSTLLLQVLLWVHTLRRLLECLFVSVFSDGVINVVQYAFGLSYYIILGLTVLCTNDSLPQ SESVSFFNQLTWYHVVGTLLFFWASFLQHQSLSLLAKMRTDSSGKVETLAHKMPCGGWFE LVSCPHYLAELLIYAAMCVCCGCASLTWWMVVLYVLCNQALAAQLCHEYYRSKFKTYPHH RKAFIPFVL
Uniprot No.

Target Background

Function
Plays a crucial role in the early stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor utilized in N-glycosylation. Acts as a polyprenol reductase, promoting the reduction of the alpha-isoprene unit of polyprenols into dolichols through a NADP-dependent mechanism. It also exhibits the ability to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Database Links
Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of srd5a3 in Danio rerio?

Srd5a3 in zebrafish functions as a polyprenol reductase, catalyzing the conversion of polyprenol to dolichol - a critical step in the dolichol biosynthesis pathway. This pathway is essential for N-glycosylation, a fundamental post-translational modification process. Based on orthologous genes in other organisms, zebrafish srd5a3 likely catalyzes the reduction of the alpha-isoprene unit in polyprenol to produce dolichol, similar to its function in humans . Disruption of this enzyme leads to abnormal levels of metabolites in the mevalonate pathway, including decreased levels of dolichol, which has been observed in other model organisms with mutations in this gene .

How conserved is srd5a3 between zebrafish and humans?

While the search results don't provide specific sequence homology data, functional studies suggest significant conservation of the srd5a3 gene between zebrafish and humans. This conservation is supported by the existence of multiple research models (yeast, worm, zebrafish, and mouse) that display similar phenotypes when the gene is disrupted . The dolichol biosynthesis pathway is highly conserved across species, indicating that the zebrafish srd5a3 likely shares functional domains and catalytic mechanisms with its human ortholog.

What developmental processes in zebrafish might be affected by srd5a3 expression?

Based on human SRD5A3-CDG phenotypes, zebrafish srd5a3 is likely critical for:

  • Eye development - Human SRD5A3-CDG patients universally present with ophthalmological abnormalities including early-onset retinal dystrophy and optic nerve hypoplasia .

  • Central nervous system development - SRD5A3 deficiency in humans causes neurological symptoms including intellectual disability, ataxia, and hypotonia .

  • Skin development - Ichthyosiform skin lesions are observed in human patients .

In zebrafish, researchers should examine these systems carefully when working with srd5a3 models, as they represent likely developmental processes requiring proper glycosylation facilitated by srd5a3 function.

How do zebrafish srd5a3 knockout models compare to other model organisms?

Zebrafish srd5a3 models should be evaluated in comparison to the following established models:

Model OrganismKey PhenotypesBiochemical FeaturesReference
Yeast (dfg10 mutant)Growth delaysHypoglycosylation of secreted proteins; Elevated polyprenol; Reduced dolichol
C. elegans (srd5a3 KO)Reduced lifespan; Developmental delay; Slow motility; Reduced progenyDecreased dolichol levels; Differential expression of ER stress genes
Mouse (cerebellum-specific KO)Motor coordination defects; Abnormal granule cell developmentImpaired IgSF-CAM-mediated neurite growth and axon guidance

Zebrafish models would be expected to display visual system defects, motor abnormalities, and potentially other phenotypes that could be analyzed during early development due to the transparent nature of zebrafish embryos. This makes them particularly valuable for studying the role of srd5a3 in ocular development, which is a primary feature of SRD5A3-CDG in humans .

What is the optimal experimental design for assessing glycosylation defects in zebrafish srd5a3 models?

For comprehensive assessment of glycosylation defects:

  • Biochemical analysis:

    • Liquid chromatography-mass spectrometry (LC-MS/MS) to quantify dolichol and polyprenol levels in zebrafish tissues

    • Analysis of N-glycan profiles using HPLC or mass spectrometry

    • Western blot analysis with glycan-specific antibodies

  • Developmental analysis:

    • High-resolution imaging of eye development (retina and optic nerve formation)

    • Behavioral assays to assess motor function and coordination

    • Histological examination of CNS structures, particularly cerebellum development

  • Molecular pathway analysis:

    • RNA-seq to identify differentially expressed genes related to ER stress response

    • Examination of IgSF-CAM glycosylation and function in neurite outgrowth

This multi-level approach would provide a comprehensive picture of how srd5a3 deficiency affects glycosylation in zebrafish and how this relates to the phenotypes observed.

How can CRISPR/Cas9 gene editing be optimized for generating precise srd5a3 mutations in zebrafish?

When designing CRISPR/Cas9 strategies for zebrafish srd5a3:

  • Target selection:

    • Design gRNAs targeting early coding exons to ensure complete loss of function

    • Consider creating a W6X mutation to mirror the most common human SRD5A3-CDG mutation (W19X) as implemented in C. elegans models

    • Use multiple gRNAs to increase efficiency and enable deletion of critical functional domains

  • Validation strategies:

    • Sequence verification of mutations

    • RT-PCR and Western blot to confirm loss of transcript and protein

    • Biochemical assays to validate loss of polyprenol reductase activity

    • Rescue experiments with wild-type srd5a3 mRNA to confirm specificity

  • Phenotypic characterization timeline:

    • Early development (1-5 dpf): Eye formation, CNS development

    • Larval stage (5-14 dpf): Visual function, swimming behavior

    • Juvenile/adult: Fertility, lifespan analysis

This approach would enable the creation of disease-relevant zebrafish models that could be directly compared to human SRD5A3-CDG patients and other model organisms.

What are the optimal conditions for expressing and purifying recombinant Danio rerio srd5a3?

For successful expression and purification of functional recombinant zebrafish srd5a3:

  • Expression system selection:

    • Prokaryotic: E. coli BL21(DE3) with membrane protein optimization

    • Eukaryotic: Insect cells (Sf9 or Hi5) using baculovirus system (preferred for membrane proteins)

    • Yeast: Pichia pastoris for proper folding of membrane proteins

  • Construct design:

    • Include affinity tags (His6 or FLAG) for purification

    • Consider fusion partners (MBP, GST) to enhance solubility

    • For functional studies, avoid mutating critical residues like H296 which has been identified as important in human SRD5A3

  • Purification strategy:

    • Detergent screening to identify optimal solubilization conditions

    • Two-step purification using affinity chromatography followed by size exclusion

    • Quality control by SDS-PAGE, Western blot, and activity assay

This approach builds on strategies used for human SRD5A3 expression, adapting them to the zebrafish ortholog for structural and functional studies .

How can the enzymatic activity of recombinant zebrafish srd5a3 be measured in vitro?

Based on established methods for human SRD5A3:

  • Substrate preparation:

    • Synthesize or source polyprenol (C80-C100) as substrate

    • Ensure substrate purity via HPLC analysis

  • Activity assay:

    • Incubate purified enzyme with polyprenol substrate and NADPH cofactor

    • Monitor reaction progress via LC-MS/MS analysis of polyprenol consumption and dolichol production

    • Quantify enzyme kinetics (Km, Vmax) under varying conditions

  • Inhibitor studies:

    • Test known inhibitors of human SRD5A3

    • Assess specificity of inhibition through mutagenesis of conserved residues

    • Develop structure-activity relationships for novel inhibitors

The methodology should be adapted from the in vitro 5α-steroid reductase reaction techniques used to validate human SRD5A3 activity, which employed liquid chromatography-tandem mass spectrometry analysis .

What approaches can be used to study the role of zebrafish srd5a3 in retinal development and function?

Given the prominent ocular phenotypes in human SRD5A3-CDG patients:

  • Cellular analysis:

    • Immunohistochemistry to examine retinal cell layer organization

    • Transmission electron microscopy to assess photoreceptor outer segment structure

    • Analysis of optic nerve formation and myelination

  • Functional assessment:

    • Electroretinography (ERG) to measure retinal responses to light stimuli

    • Optomotor response (OMR) and optokinetic response (OKR) behavioral assays

    • Visual prey capture assays to assess integrated visual function

  • Molecular analysis:

    • Expression profiling of retina-specific IgSF-CAMs that require glycosylation

    • Analysis of N-glycan profiles in retinal tissue

    • Rescue experiments with human SRD5A3 to assess functional conservation

These approaches are particularly valuable given the findings in human SRD5A3-CDG patients, where fundus imaging has revealed specific patterns of retinal dystrophy with loss of ellipsoid layers outside the perifoveal region and other distinctive features .

How can zebrafish srd5a3 models be used to screen potential therapies for SRD5A3-CDG?

Zebrafish offer significant advantages for therapeutic screening:

  • High-throughput screening approaches:

    • Embryonic exposure to small molecule libraries

    • Assessment of rescue effects on visible phenotypes (eye development, motor function)

    • Biochemical validation of glycosylation improvement

  • Gene therapy approaches:

    • AAV-mediated delivery of wild-type srd5a3

    • mRNA injection at early developmental stages

    • CRISPR-based correction of specific mutations

  • Pathway modulation:

    • Targeting downstream effectors in the glycosylation pathway

    • Enhancing alternative glycosylation routes

    • Reducing ER stress response activation

The ability to rapidly assess phenotypic rescue in transparent embryos makes zebrafish particularly valuable for initial therapeutic screening before advancing to mammalian models .

What biomarkers can be used to track disease progression and therapeutic efficacy in zebrafish srd5a3 models?

Multiple biomarker approaches can be implemented:

Biomarker TypeSpecific MeasurementsRelevance to SRD5A3-CDGDetection Method
BiochemicalDolichol:polyprenol ratioDirect measure of enzyme activityLC-MS/MS
GlycomicN-glycan profile alterationsReflects downstream effects on glycosylationMass spectrometry
CellularER stress markers (BiP, CHOP)Indicates cellular response to glycosylation defectsqPCR, Western blot
PhysiologicalVisual function metricsReflects functional impact on primary affected systemERG, behavioral assays
DevelopmentalEye morphology parametersQuantifiable measure of developmental impactMicroscopy, morphometrics

These biomarkers would provide quantitative metrics for assessing disease severity and therapeutic efficacy, bridging the gap between molecular mechanisms and phenotypic outcomes.

How do metabolic interventions affect dolichol biosynthesis in zebrafish srd5a3 models?

Investigating metabolic interventions would involve:

  • Supplementation strategies:

    • Dolichol precursor administration

    • Mevalonate pathway metabolite supplementation

    • Examination of effects on glycoprotein synthesis and function

  • Diet modification approaches:

    • Effects of altered carbohydrate intake on alternative glycosylation pathways

    • Lipid composition changes and impact on membrane dynamics

    • Fasting/feeding cycles and metabolic regulation of glycosylation

  • Metabolic pathway modulation:

    • HMG-CoA reductase inhibitors (statins) and their impact on polyprenol availability

    • Mevalonate pathway enzyme modulation

    • Cross-talk between dolichol biosynthesis and other isoprenoid pathways

This work would build on findings from other model organisms, such as the worm model showing differential expression of ER stress-related genes and abnormal levels of metabolites in the mevalonate pathway .

How does zebrafish srd5a3 function compare to its orthologs in other vertebrate models?

A comprehensive comparison across vertebrate models reveals:

  • Functional conservation:

    • Similar enzymatic activity (polyprenol to dolichol conversion) across vertebrates

    • Conserved role in N-glycosylation pathway

    • Comparable developmental roles, particularly in visual system development

  • Model-specific advantages:

    • Zebrafish: Rapid development, transparent embryos, high-throughput screening capacity

    • Mouse: Mammalian physiology, tissue-specific knockout capabilities

    • Human cell models: Direct relevance to human disease, personalized medicine approaches

  • Comparative phenotypes:

    • Similar retinal phenotypes across vertebrate models

    • Conservation of neurological impacts, particularly cerebellum development

    • Species-specific manifestations of glycosylation defects

This comparative approach leverages the strengths of each model system to build a comprehensive understanding of srd5a3 function across vertebrates .

What insights from human SRD5A3-CDG patients can inform zebrafish experimental design?

Human SRD5A3-CDG clinical findings provide valuable guidance for zebrafish studies:

  • Key phenotypic targets:

    • Early-onset retinal dystrophy and optic nerve hypoplasia (universal in patients)

    • Cerebellar development and function (ataxia in approximately 45% of patients)

    • Ichthyosiform skin lesions (observed in ~63% of patients)

  • Temporal considerations:

    • Timing of symptom onset (nystagmus ~3 months, motor delay ~15 months, speech delay ~26 months)

    • Progressive nature of certain phenotypes

    • Age-dependent manifestations requiring long-term monitoring

  • Phenotypic variability:

    • Intra-familial variability suggests genetic modifiers

    • Variable expressivity of neurological symptoms

    • System-specific severity differences

This human-informed approach ensures that zebrafish models are designed to capture the most relevant aspects of SRD5A3-CDG pathophysiology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.