Recombinant Danio rerio Probable signal peptidase complex subunit 2 (spcs2)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Danio rerio Probable Signal Peptidase Complex Subunit 2 (spcs2) refers to a protein subunit of the signal peptidase complex (SPC) in zebrafish (Danio rerio) produced through recombinant DNA technology . The signal peptidase complex is responsible for cleaving N-terminal signal sequences from newly synthesized proteins as they are moved into the endoplasmic reticulum (ER) .

Aliases for SPCS2 Gene :

  • SPCS2

  • KIAA0102

  • Microsomal Signal Peptidase 25 KDa Subunit

  • Signal Peptidase 25kDa Subunit

  • SPase 25 KDa Subunit

  • Signal Peptidase Complex Subunit 2 Homolog (S. Cerevisiae)

  • Signal Peptidase Complex Subunit 2 Homolog

  • SPC25

Function and Characteristics

SPCS2 is a component of the SPC, which is essential for protein maturation and translocation across the ER membrane . It enhances the enzymatic activity of SPC and facilitates the interactions between different components of the translocation site .

Gene Ontology (GO) Annotations :

  • Peptidase activity

  • Protein targeting to ER

  • Signal peptide processing

Molecular Evolution and Functional Divergence

Zebrafish (Danio rerio) is a suitable model to study glucose-induced human disease . Zebrafish possess an intrinsic autonomous oscillator composed of components similar to those found in mammals .

Expression and Subcellular Localization

SPCS2 is predicted to be located in the endoplasmic reticulum membrane and is part of the signal peptidase complex .

Research Applications

Recombinant SPCS2 is utilized in research for various purposes:

  • ELISA assays: Recombinant Danio rerio Probable signal peptidase complex subunit 2(spcs2) is used in ELISA assays .

  • Studies of protein processing: It is valuable in studying protein targeting, translocation, and signal peptide processing within the endoplasmic reticulum .

  • Understanding zebrafish peptidome: It contributes to the molecular understanding of zebrafish and its use as a model for human diseases .

  • Drug discovery: As a protein coding gene, SPCS2 may be relevant in studies related to infectious diseases and in incretin synthesis, secretion, and inactivation .

Related Diseases

Diseases associated with SPCS2 include spinocerebellar ataxia 13 .

Experimental Analysis

ExperimentDescription
ImmunofluorescenceTransfected cells are fixed, permeabilized, and immunolabeled using primary and secondary antibodies to observe subcellular localization. Confocal microscopy is used for examination.
Subcellular FractionationCOS7 cells are transfected with recombinant vectors, and cell materials are separated into soluble and particulate fractions via ultracentrifugation. Western blot analysis is then performed to confirm the localization of zebrafish sialidase enzymes.
Zebrafish Neu ActivityCOS7 cells are pulsed with [1-3H]sphingosine and transfected with recombinant plasmids carrying zebrafish cDNAs to assess sialidase activity. The lipid pattern detectable in mock and transfected cells is compared to determine the effects of enzyme expression on the sphingolipid compartment of intact cells. Variations in ganglioside content (e.g., GM3 and GM1) are measured.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
spcs2; zgc:110364; Probable signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
spcs2
Target Protein Sequence
MAARNGKNSILEKWRIDEKPVKIDKWDGAAVKNSLDDAAKKVLIEKYGYLESFNLVDGRL FICTVSCLFTIVALIWDYLHPFPESKPVLACCVVSYFIMMGILTLYTSYKEKNIFLVAMQ KDPAGMDPDHSWCLSSSLKRFDDQYTLRMSFTDGKTKQSRETEFTKSVSVFFDENGTLVM DQYEKYVSKLHDTLATEKKTK
Uniprot No.

Target Background

Function

Microsomal signal peptidase is a membrane-bound endoproteinase responsible for removing signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links
Protein Families
SPCS2 family
Subcellular Location
Membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How does zebrafish spcs2 compare to human SPCS2?

Zebrafish spcs2 is orthologous to human SPCS2, sharing significant sequence homology and functional conservation. This evolutionary conservation makes zebrafish an excellent model for studying fundamental aspects of signal peptide processing .

The conservation between zebrafish and human proteins follows the general pattern observed in comparative proteomics studies of these species, where vertebrate PSD (postsynaptic density) proteins show higher levels of conservation than proteins exclusive to one species . While the exact percentage identity between zebrafish spcs2 and human SPCS2 is not specified in the provided materials, proteomic studies of zebrafish-human protein conservation generally show median sequence identities of approximately 70-75% for conserved proteins.

This conservation extends to functional domains, with both proteins containing the signal peptidase complex subunit 2 family domain (IPR009582) , indicating preserved biochemical activity across vertebrate evolution.

What is the genomic location and organization of the spcs2 gene in zebrafish?

The spcs2 gene in zebrafish is located on chromosome 15. According to the ZFIN database, it was previously known by alternative names including wu:fa12g08 and zgc:110364 . The gene encodes at least two transcript variants:

TranscriptAnnotation MethodLength (nt)
spcs2-201Ensembl1,182 nt
spcs2-202Ensembl1,201 nt

The gene belongs to the protein_coding_gene type classification in the zebrafish genome database . Understanding the genomic organization is essential for designing gene-targeting experiments, creating transgenic models, or performing gene expression analyses.

What are the optimal conditions for storing and handling recombinant Danio rerio spcs2 protein?

For optimal handling of recombinant Danio rerio spcs2:

  • Storage buffer: The protein is best maintained in a Tris-based buffer with 50% glycerol, specifically optimized for this protein .

  • Temperature conditions:

    • Long-term storage: Store at -20°C or -80°C

    • Working stocks: Store aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this can lead to protein degradation and loss of activity

  • Handling precautions:

    • When preparing working dilutions, use cold buffers

    • Keep the protein on ice when working at the bench

    • Consider adding protease inhibitors to prevent degradation during experimental procedures

These conditions minimize protein denaturation and maintain functional integrity of the recombinant spcs2 protein for experimental applications .

What expression systems are most effective for producing functional recombinant zebrafish spcs2?

While specific expression systems for zebrafish spcs2 aren't detailed in the provided materials, general principles for membrane-associated proteins can be applied:

  • Mammalian expression systems:

    • COS7 cells have been successfully used for expressing and studying membrane-associated proteins from zebrafish, including proper subcellular localization .

    • These systems provide appropriate post-translational modifications and often correctly fold membrane proteins like spcs2.

  • Considerations for methodology:

    • For functional studies, include appropriate tags (e.g., Myc tag) for detection and purification

    • When designing expression constructs, consider that the tag type may influence localization and function

    • Full-length expression (region 1-201) is recommended to maintain structural integrity

  • Validation approaches:

    • Western blot analysis with anti-tag antibodies can confirm expression

    • Subcellular fractionation methods (including ultracentrifugation at 100,000g) can help verify proper membrane association

    • Confocal microscopy with fluorescent tags or immunofluorescence can confirm ER localization

What methodologies are most appropriate for studying spcs2 interactions within the signal peptidase complex?

To investigate protein interactions within the signal peptidase complex:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of spcs2 and potential interacting proteins

    • Use cross-linking agents to stabilize transient interactions

    • Perform immunoprecipitation with anti-tag antibodies

    • Analyze precipitated complexes by western blotting or mass spectrometry

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins can identify proteins in close proximity to spcs2

    • These methods are particularly valuable for membrane proteins like spcs2 where traditional pull-downs may disrupt interactions

  • Fluorescence techniques:

    • FRET (Förster Resonance Energy Transfer) can assess direct protein interactions

    • Split-GFP complementation can detect protein proximity in live cells

    • Confocal microscopy with appropriate co-localization controls is essential for validating interaction candidates

  • Preparation of microsomal fractions:

    • Ultracentrifugation at 100,000g for 60 minutes can separate membrane fractions containing the signal peptidase complex

    • Compare supernatant and pellet fractions to determine membrane association properties

How can CRISPR/Cas9 be used to generate zebrafish spcs2 mutants for functional studies?

Creating spcs2 mutants using CRISPR/Cas9 requires careful design and validation:

  • Target site selection:

    • Design guide RNAs targeting conserved functional domains within the spcs2 gene

    • The signal peptidase complex subunit 2 family domain (IPR009582) would be an optimal target region

    • Ensure target sites avoid SNP locations by consulting population genomic data of wild zebrafish populations

  • Methodological approach:

    • Inject one-cell stage embryos with Cas9 protein and guide RNA

    • Screen F0 mosaic founders by fin clipping and sequencing

    • Establish stable lines through F1 and F2 generations

    • Validate mutations at genomic, transcript, and protein levels

  • Phenotypic analysis:

    • Assess developmental phenotypes at various stages

    • Examine ER stress markers and protein secretion defects

    • Consider using tissue-specific knockouts if complete knockout causes embryonic lethality, similar to approaches used for ptpn11a mutants

  • Complementation studies:

    • Test rescue by transient expression of wild-type spcs2 or human SPCS2

    • Comparative rescue experiments can determine functional conservation between zebrafish and human orthologs, following approaches similar to those used in ptpn11 studies

What biochemical assays can measure signal peptidase activity in zebrafish models?

To assess signal peptidase complex activity involving spcs2:

  • In vitro cleavage assays:

    • Prepare microsomal fractions from zebrafish tissues or cell lines

    • Use synthetic peptide substrates containing canonical signal sequences

    • Analyze cleavage products by HPLC, mass spectrometry, or gel electrophoresis

    • Compare activity between wild-type and spcs2-manipulated samples

  • Reporter systems:

    • Design constructs with signal peptides fused to reporter proteins (GFP, luciferase)

    • Quantify processing efficiency by measuring reporter localization or activity

    • Include control constructs with mutated signal sequences

  • Proteomic approach:

    • Compare N-terminal peptides from secreted or membrane proteins

    • Identify alterations in signal peptide processing in spcs2-deficient models

    • Apply techniques similar to those used in the zebrafish proteomic studies

  • Zebrafish-specific considerations:

    • Developmental stage-specific analysis may reveal temporal requirements for spcs2

    • Tissue-specific differences in signal peptide processing can be assessed through microdissection and subsequent biochemical analysis

How does disruption of spcs2 affect zebrafish development and protein trafficking?

While specific phenotypes of spcs2 disruption are not detailed in the provided materials, we can predict likely outcomes based on its function and studies of similar proteins:

  • Developmental effects:

    • Potential embryonic lethality if complete loss of function occurs, similar to other essential ER proteins

    • Possible tissue-specific defects in high-secretory tissues (pancreas, liver, neural tissues)

    • Consider both maternal and zygotic contributions when analyzing early developmental phenotypes

  • Cellular consequences:

    • Accumulation of unprocessed proteins in the ER

    • Activation of the unfolded protein response (UPR)

    • Defects in protein secretion and membrane protein localization

  • Experimental approaches:

    • Use morpholino knockdown for temporal control of spcs2 reduction

    • Apply live imaging techniques to visualize protein trafficking defects

    • Implement conditional knockout strategies if complete knockout is lethal

    • Compare knockout/knockdown phenotypes to human disease models with SPCS2 mutations

  • Analysis methods:

    • Western blotting to detect accumulation of unprocessed precursor proteins

    • Immunofluorescence to assess subcellular protein localization

    • RT-qPCR to measure UPR gene expression

    • Transmission electron microscopy to visualize ER morphology changes

How have population genomic studies informed our understanding of spcs2 conservation and variation?

Population genomic studies provide valuable insights into spcs2 evolution:

How can the study of zebrafish spcs2 inform human disease mechanisms related to protein processing defects?

Zebrafish spcs2 studies provide valuable insights into human disease:

  • Model system advantages:

    • Zebrafish offer advantages for studying protein function including short generation interval, rapid development, high fecundity, and transparent embryos

    • The orthologous relationship between zebrafish spcs2 and human SPCS2 allows direct translational relevance

  • Disease relevance:

    • Defects in signal peptide processing are associated with various human diseases

    • Zebrafish models can reveal developmental and physiological consequences of disrupted protein processing

    • The conserved nature of the signal peptidase complex makes findings potentially applicable to human pathologies

  • Experimental approaches:

    • Create zebrafish models mimicking human SPCS2 mutations

    • Perform rescue experiments with human SPCS2 variants to test functional conservation

    • Conduct drug screens using spcs2-mutant zebrafish to identify compounds that modulate ER stress or protein processing

  • Methodological considerations:

    • Use the sequential parallel comparison design (SPCD) approach when conducting drug efficacy studies to increase statistical power and reliability

    • Combine proteomics, genetics, and cell biology approaches for comprehensive phenotypic characterization

What are the common pitfalls when working with recombinant zebrafish membrane proteins like spcs2?

Researchers should be aware of several technical challenges:

  • Protein stability issues:

    • Membrane proteins like spcs2 may denature during purification and storage

    • Store in optimized buffer (Tris-based with 50% glycerol) at appropriate temperatures (-20°C or -80°C)

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Solubility challenges:

    • Signal peptidase complex proteins contain hydrophobic transmembrane regions

    • Consider using mild detergents during extraction and purification

    • For functional studies, maintain the native membrane environment when possible

  • Expression system limitations:

    • Heterologous expression may result in misfolding or mislocalization

    • Validate subcellular localization using immunofluorescence or fractionation

    • Consider zebrafish cell lines for more native expression conditions

  • Functional assessment:

    • Design activity assays that account for membrane association

    • Include positive controls with known activity in all enzymatic assays

    • Consider reconstitution into liposomes or nanodiscs for in vitro studies

How can researchers differentiate between direct and indirect effects when studying spcs2 function?

To distinguish direct from indirect effects:

  • Acute vs. chronic manipulation:

    • Compare rapid inhibition (e.g., small molecule inhibitors) with genetic knockouts

    • Use inducible or conditional systems to control timing of spcs2 disruption

    • Temporal analysis can help separate primary from secondary effects

  • Rescue experiments:

    • Perform structure-function studies with mutated versions of spcs2

    • Test domain-specific contributions to phenotypes

    • Include catalytically inactive mutants as controls

  • Substrate specificity:

    • Identify direct substrates using proteomics approaches

    • Compare changes in the N-terminal peptidome between control and spcs2-deficient samples

    • Validate direct interactions using in vitro reconstitution experiments

  • Systems biology approach:

    • Combine transcriptomics, proteomics, and metabolomics

    • Network analysis can help distinguish direct targets from downstream effects

    • Apply methods similar to those used in zebrafish peroxisomal protein inventory studies

How can researchers integrate zebrafish spcs2 studies with broader proteomic approaches?

Integration of spcs2 research with proteomic approaches:

  • Comparative proteomics:

    • Compare wild-type and spcs2-mutant proteomes to identify affected pathways

    • Focus on secreted and membrane proteins that require signal peptide processing

    • Use techniques demonstrated in zebrafish synapse proteome studies

  • Protein-protein interaction networks:

    • Identify spcs2 interactors using IP-MS or proximity labeling

    • Map the complete signal peptidase complex in zebrafish

    • Compare interaction networks between zebrafish and human orthologs

  • Subcellular proteomics:

    • Isolate ER and other membrane fractions for targeted analysis

    • Quantify changes in various cellular compartments following spcs2 manipulation

    • Apply fractionation techniques similar to those used in synaptosomal purification

  • Methodological considerations:

    • Combine label-free and isotope labeling approaches for quantitative proteomics

    • Include appropriate controls to account for technical variation

    • Consider developmental timing and tissue specificity when designing experiments

    • Validate key findings with orthogonal techniques like western blotting or immunofluorescence

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.