Recombinant Danio rerio Protein C19orf12 homolog (si:ch211-238a12.2, zgc:112052)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
si:ch211-238a12.2; zgc:112052; Protein C19orf12 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
si:ch211-238a12.2
Target Protein Sequence
MPPHVDDVMKLCCELSANQQVKTAVKQSGKGAAAAGGLAFAGGLIGGPLGIAVGGAVGGL LGCWMKSGQFKPLPQVIMELTPDQQARLYEDIVAILGSITWTDVAQLTALVMGNASLQQQ VTAALLSYIHKELQAEVHYID
Uniprot No.

Target Background

Database Links

UniGene: Dr.77509

Subcellular Location
Mitochondrion. Mitochondrion membrane; Single-pass membrane protein. Endoplasmic reticulum. Cytoplasm, cytosol.

Q&A

What are the zebrafish orthologs of human C19orf12 and how are they organized genomically?

Zebrafish possess four co-orthologs of the human C19orf12 gene. One ortholog (zgc:112052) is located on chromosome 18, which we can designate as "c19orf12a." The remaining three orthologs are arranged in tandem on chromosome 7 (si:ch211_260e23.7, zgc:101715, and si:ch211_260e23.8), which can be referred to as "c19orf12b1," "c19orf12b2," and "c19orf12b3," respectively. This genomic arrangement resulted from the teleost-specific genome duplication event, with subsequent tandem duplication of the chromosome 7 gene to generate the additional copies .

How conserved are the C19orf12 protein sequences between humans and zebrafish?

The C19orf12 protein displays significant evolutionary conservation between humans and zebrafish. Multiple sequence alignment analyses reveal approximately 60% amino acid identity between human and zebrafish orthologs. Specifically, the c19orf12a protein shares 59.6% identity with the human counterpart, while c19orf12b1, c19orf12b2, and c19orf12b3 demonstrate 48.2%, 51.1%, and 55.9% identity, respectively. The main structural difference is the absence of the first 11 amino acids in zebrafish proteins that are present in the human N-terminal sequence .

How can researchers effectively create knockdown models of C19orf12 in zebrafish?

To create knockdown models of C19orf12 in zebrafish, researchers can employ morpholino-based approaches targeting translation initiation. Specifically, ATG-blocking morpholinos can be microinjected into zebrafish embryos at the 1-2 cell stage to inhibit translation of both maternal and zygotic mRNA. For c19orf12a, the most expressed ortholog, morpholino concentrations of approximately 0.3 pmol/embryo have been found effective. The specificity of morpholino effects should be validated through appropriate controls, including:

  • Using a standard control morpholino

  • Performing mRNA rescue experiments with wild-type human C19orf12 mRNA (approximately 150 pg/embryo)

  • Testing mutant forms of human C19orf12 mRNA to establish genotype-phenotype correlations

What phenotypic assays are most informative when evaluating C19orf12 knockdown in zebrafish?

Multiple complementary assays provide comprehensive evaluation of C19orf12 knockdown effects:

These methodologies provide crucial insights into the neural, muscular, and functional consequences of C19orf12 deficiency, which align with clinical manifestations observed in MPAN patients .

How does the zebrafish C19orf12 knockdown model recapitulate features of Mitochondrial membrane Protein Associated Neurodegeneration (MPAN)?

The zebrafish C19orf12 knockdown model demonstrates several phenotypic features that parallel clinical manifestations of MPAN:

MPAN Clinical FeaturesZebrafish Model Phenotypes
Progressive spastic para/tetraparesisDefective musculature formation and abnormal locomotor behavior
NeurodegenerationIncreased neuronal cell death and abnormal neural development
Optic atrophySmaller eyes and defective optic tectum development
Motor deficitsAltered swimming behavior and thinner, tilted tail
Early onset and progressive natureProgressive worsening of phenotype with 100% mortality by 7 dpf

This correlation between human pathology and zebrafish phenotypes supports the validity of this model for investigating MPAN pathogenesis and evaluating potential therapeutic approaches .

How can the C19orf12 zebrafish model be used to investigate mitochondrial dynamics and function?

The C19orf12 zebrafish model serves as an excellent platform to investigate mitochondrial dynamics through several methodological approaches:

  • Mitochondrial morphology assessment: Using transgenic lines with fluorescently labeled mitochondria (such as Tg(β-actin:mitoEGFP)) to visualize mitochondrial network organization in real-time and in vivo.

  • Mitochondrial function assays: Measuring oxygen consumption rate, membrane potential, and ATP production in isolated mitochondria from wild-type and C19orf12 knockdown embryos.

  • Mitochondria-ER contact sites (MAM) analysis: Since human C19orf12 localizes to MAM regions, investigating altered calcium homeostasis, lipid transfer, and mitochondrial fission in the zebrafish model.

  • Mitophagy and autophagy evaluation: Assessing changes in mitochondrial quality control mechanisms using LC3 immunostaining or transgenic autophagy reporters.

These approaches can provide crucial insights into how C19orf12 deficiency affects mitochondrial health and contributes to neurodegeneration .

How do C19orf12 defects interact with other pathways implicated in neurodegeneration?

The investigation of pathway interactions requires sophisticated experimental designs:

  • Double knockdown experiments: Combining C19orf12 knockdown with morpholinos targeting other NBIA-related genes (such as pank2 or coasy) to identify synergistic or antagonistic effects.

  • Transcriptomic profiling: RNA-Seq analysis of C19orf12 knockdown embryos to identify dysregulated pathways, particularly those involved in:

    • Lipid metabolism

    • Iron homeostasis

    • Mitochondrial function

    • Autophagy/mitophagy

    • Neuroinflammation

  • Metabolomic analysis: Quantification of metabolites, especially those involved in fatty acid biosynthesis and valine, leucine, and isoleucine degradation, which show co-regulation with C19orf12.

  • Rescue experiments with pathway modulators: Testing whether pharmacological activators of mitophagy, autophagy, or antioxidant systems can ameliorate C19orf12 knockdown phenotypes .

What are the functional differences between the four zebrafish C19orf12 orthologs and how can they be experimentally distinguished?

To distinguish the functions of the four zebrafish orthologs, researchers can implement several strategic approaches:

  • Paralog-specific knockdown: Design morpholinos or CRISPR-Cas9 guide RNAs targeting each ortholog individually to compare resulting phenotypes.

  • Rescue experiments with specific paralogs: Microinjection of mRNA from individual zebrafish orthologs into c19orf12a morphants to assess functional redundancy or specificity.

  • Tissue-specific expression analysis: Using in situ hybridization or transgenic reporter lines to map the expression patterns of each ortholog during development.

  • Biochemical characterization: Expressing recombinant proteins of each ortholog to analyze differences in:

    • Subcellular localization

    • Protein interaction partners

    • Post-translational modifications

    • Membrane association capabilities

These experiments would clarify whether the four co-orthologs have undergone subfunctionalization or neofunctionalization during evolution and explain why c19orf12a appears to play a predominant role in development .

What are the optimal conditions for expressing and purifying recombinant Danio rerio C19orf12 homolog proteins?

Optimal expression and purification of recombinant zebrafish C19orf12 proteins requires careful consideration of the protein's properties:

  • Expression system selection:

    • Bacterial systems (E. coli) may be suitable for cytosolic domains

    • Eukaryotic systems (insect cells, yeast) are preferable for full-length proteins due to potential membrane interactions via glycine-zipper motifs

  • Solubility enhancement strategies:

    • Fusion tags (MBP, SUMO, GST) to improve solubility

    • Detergent screening for membrane-associated domains

    • Co-expression with binding partners

  • Purification protocol optimization:

    • Two-step affinity chromatography followed by size exclusion

    • Buffer optimization including mild detergents for membrane-associated regions

    • Reducing agents to prevent oxidation of cysteine residues

  • Quality control assessments:

    • Circular dichroism to verify proper folding

    • Dynamic light scattering to confirm monodispersity

    • Mass spectrometry to verify protein integrity

These methodological considerations are crucial for obtaining functional recombinant protein for downstream structural and functional studies .

How can researchers effectively analyze the subcellular localization and interactions of C19orf12 in zebrafish models?

Multiple complementary approaches can be employed to analyze C19orf12 subcellular localization and interactions:

  • Fluorescent protein fusion constructs:

    • Generation of C19orf12-GFP fusion constructs for in vivo visualization

    • Colocalization studies with organelle markers (MitoTracker, ER-Tracker)

    • Live imaging in transparent zebrafish embryos

  • Immunohistochemistry techniques:

    • Development of paralog-specific antibodies

    • Co-staining with markers for mitochondria, ER, and MAM

    • Super-resolution microscopy for detailed localization analysis

  • Biochemical fractionation:

    • Isolation of mitochondria, ER, and MAM fractions from zebrafish tissues

    • Western blot analysis for ortholog-specific detection

    • Mass spectrometry-based proteomic analysis of isolated fractions

  • Protein-protein interaction studies:

    • Co-immunoprecipitation from zebrafish lysates

    • Proximity labeling approaches (BioID, APEX) in vivo

    • Yeast two-hybrid or mammalian two-hybrid screening with zebrafish c19orf12 as bait

These methodologies provide a comprehensive toolkit for investigating the molecular function and interaction network of C19orf12 within the cellular environment .

How can the zebrafish C19orf12 model be utilized for high-throughput drug screening for MPAN therapeutics?

The zebrafish C19orf12 model offers several advantages for high-throughput drug screening:

  • Screening methodology design:

    • Automated morphological phenotype assessment using bright-field imaging

    • Functional locomotor assays using automated tracking systems

    • Transgenic reporter lines for monitoring neuronal health or mitochondrial function

  • Compound libraries and administration protocols:

    • Test compounds can be added directly to water for uptake through skin/gills

    • Timed administration to determine critical therapeutic windows

    • Concentration gradients to establish dose-response relationships

  • Readout optimization and quantification:

    • Quantitative scoring systems for morphological rescue

    • Automated behavioral tracking for functional recovery

    • Molecular markers of rescue (gene expression, protein levels)

  • Validation pathway for promising compounds:

    • Secondary assays in zebrafish for mechanism validation

    • Testing in mammalian cellular models of MPAN

    • Pharmacokinetic and safety profiling

This framework enables efficient screening of compound libraries to identify molecules that might ameliorate C19orf12 deficiency phenotypes and potentially lead to therapeutic strategies for MPAN patients .

How does the functional characterization of disease-associated C19orf12 mutations in zebrafish compare with clinical observations in patients?

Comparative analysis between zebrafish models and clinical observations requires systematic experimental design:

  • Mutation panel creation:

    • Generate a panel of known pathogenic human C19orf12 mutations (e.g., G58S)

    • Introduce equivalent mutations in zebrafish orthologs

    • Create stable transgenic lines expressing mutant forms

  • Phenotype severity correlation:

    • Compare phenotypic severity in zebrafish with clinical severity in patients

    • Establish genotype-phenotype correlations across multiple mutations

    • Document age of onset and progression patterns

  • Tissue-specific effects:

    • Analyze neural vs. muscular pathology across different mutations

    • Compare with predominant clinical manifestations (e.g., predominantly neurological vs. myopathic)

    • Document tissue-specific molecular signatures

  • Cross-species rescue experiments:

    • Test ability of wild-type human C19orf12 to rescue zebrafish knockdown

    • Compare rescue efficiency of different mutant forms

    • Correlate rescue potential with residual function in patients

This approach facilitates translational insights between zebrafish models and human pathology, potentially revealing mutation-specific therapeutic strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.