Recombinant Danio rerio Protein cornichon homolog 2 (cnih2)

Shipped with Ice Packs
In Stock

Description

General Information

Danio rerio Protein Cornichon Homolog 2 (Cnih2) is a protein that, in zebrafish, is ubiquitously expressed throughout the embryo from fertilization onward and accumulates at higher levels in cells of the telencephalon and the ventral hindbrain . Cnih2 belongs to a conserved protein family found in eukaryotes .

Structure and Function

Plant cornichon homologs have about 40% similarity to cornichons in yeast, flies, worms, zebra fish, and humans . The protein is predicted to have three membrane-spanning α-helixes, with the N-terminus towards the cytoplasm and the C-terminus located in the ER lumen . All plant cornichon homologs possess an acidic domain in the luminal C-terminus .

Cnih2 is an auxiliary subunit of the ionotropic glutamate receptor of the AMPA subtype . Cnih2 proteins participate in the selection of integral membrane proteins as cargo for their correct targeting . Cnih2 may act as a cargo receptor, located in the endoplasmic reticulum, interacting with other proteins for their delivery to the Golgi apparatus .

Expression and Localization

  • Cnih2 is expressed in the brain, diencephalon, and tegmentum .

  • In rice, cornichon homologues did not locate exclusively to one specific compartment but rather circulated actively between the Golgi and the ER, in association with COPII vesicles .

Research Findings

  • In mouse models, Cnih2 conditional knockout mice exhibit reduced AMPA receptor synaptic transmission in the hippocampus .

  • Significant upregulation of CNIH2 has been found to promote esophageal squamous cell carcinoma progression .

  • The cargo receptor cornichon interacts with the low-affinity Na+ transporter OsHKT1;3 for its delivery to the Golgi apparatus .

  • The interaction between OsHKT1;3 and OsCNIH1 occurs at the ER and is required to direct the Na+ transporter to the Golgi .

Table of Cnih2 Information

FeatureDescription
NameRecombinant Danio rerio Protein cornichon homolog 2 (cnih2)
FunctionAuxiliary subunit of AMPA receptor; Protein trafficking
ExpressionUbiquitously expressed throughout the Danio rerio embryo from fertilization onward ; brain, diencephalon, and tegmentum
LocalizationMembrane , Golgi and ER
OrganismDanio rerio (zebrafish)
Molecular Weight18.9 kDa (mouse)
Storage BufferTris-based buffer, 50% glycerol (zebrafish)
Related DiseasesSchizophrenia , Esophageal squamous cell carcinoma
Amino Acid SequenceMAFTFAAFCYmLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERICNLLRRLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPVSVMNADILNYCQKESWCKLGFYLLSFFYYLYSMVYALVSF (zebrafish)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cnih2; zgc:101874; Protein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cnih2
Target Protein Sequence
MAFTFAAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERI CNLLRRLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPV SVMNADILNYCQKESWCKLGFYLLSFFYYLYSMVYALVSF
Uniprot No.

Target Background

Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs).
Database Links
Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.