Recombinant Danio rerio Protein FAM151A (fam151a)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Protein FAM151A (fam151a)

Family with sequence similarity 151 member A (FAM151A) is a protein that, in humans, is encoded by the FAM151A gene . It is a transmembrane protein expressed in kidney tubules and is an ortholog of menorin, a protein participating in neuron development in nematodes . Recombinant Danio rerio Protein FAM151A (fam151a) is the Danio rerio (zebrafish) version of this protein produced using recombinant DNA technology .

Gene Information

The human FAM151A gene is located on the minus strand of chromosome 1 at 1p32.3, spanning roughly 14 kbp and containing 8 exons . The last exon comprises approximately half the coding sequence and overlaps with the 3' UTR of the ACOT11 gene. There are no known alternative splicings of FAM151A .

Protein Structure and Function

The FAM151A protein has three known domains: one transmembrane domain and two domains of unknown function (DUF2181) . DUF2181 belongs to the GDPD/PLCD superfamily, known for hydrolyzing glycerophosphodiester bonds. One of the DUF2181 domains in FAM151A is hypothesized to be nonfunctional via homology analysis. The molecular weight of FAM151A is about 95 kDa .

Expression Patterns

FAM151A mRNA transcripts are expressed in the kidney, small intestine, and liver, but the FAM151A protein is only expressed in kidney tubules .

Evolutionary Aspects

FAM151A has direct orthologs in species such as chimpanzees, mice, and zebrafish, as well as other members of Eumetazoa that diverged from humans up to around 700 million years ago. Birds do not have any known orthologs of FAM151A . In mammals, FAM151A and FAM151B are homologs of the C. elegans menorin gene, which is involved in dendrite branching .

Clinical Significance

The SNP rs11206394 in FAM151A is a significant predictor of colorectal cancer . This missense mutation occurs in the region of the second DUF2181 of FAM151A that overlaps with the 3' UTR of ACOT11. Individuals carrying two copies of the minor allele have shown a decrease in the odds of cancer between 11% and 59% .

Recombinant Production

Recombinant Danio rerio Protein FAM151A (fam151a) is produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells .

Role in Zebrafish Development

A systematic proteomics study on zebrafish embryonic development identified FAM151A among 5961 proteins across 10 stages of early development, providing insights into the molecular mechanisms of zebrafish development .

Functional Partners

Predicted functional partners of FAM151A include PLEKHH3, CRB2, and FETUB .

  • PLEKHH3: Pleckstrin homology, MyTH4, and FERM domain-containing H3

  • CRB2: Protein crumbs homolog 2, which has a central role during the epithelial-to-mesenchymal transition (EMT) at gastrulation

  • FETUB: Fetuin-B, a protease inhibitor required for egg fertilization

FAM151A Expression in Cancer Tissues

FAM151A expression has been studied in 20 different cancers via antibody staining. RNA expression data from The Cancer Genome Atlas (TCGA) is also available .

Data Tables

FeatureDescription
AliasesFAM151A, C1orf179, family with sequence similarity 151 member A
External IDsMGI: 2657115; HomoloGene: 17143; GeneCards: FAM151A; OMA:FAM151A - orthologs
LocationChromosome 1p32.3
OrthologsChimpanzee, mouse, zebrafish, and other members of the clade Eumetazoa
ParalogFAM151B
Molecular Weight~95 kDa
DomainsOne transmembrane domain and two domains of unknown function (DUF2181)
mRNA ExpressionKidney, small intestine, and liver
Protein ExpressionKidney tubules
SNP rs11206394 SignificancePredictor of colorectal cancer; Individuals with both copies of the minor allele have decreased odds of cancer between 11% and 59%
Recombinant SourcesYeast, E. coli, Baculovirus, Mammalian cell
Functional PartnerDescription
PLEKHH3Pleckstrin homology, MyTH4, and FERM domain containing H3
CRB2Apical polarity protein that plays a central role during the epithelial-to-mesenchymal transition (EMT) at gastrulation, when newly specified mesodermal cells move inside the embryo. Acts by promoting cell ingression, the process by which cells leave the epithelial epiblast and move inside the embryo to form a new tissue layer.
FETUBProtease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fam151a; si:ch211-215b16.4; Protein FAM151A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
fam151a
Target Protein Sequence
MEVKEEKSCSIGEGEEAEGKEAKTVLGIFTREQFIMLCVGLGLIALLLIITLTSVFVIAK SDASVDVDMEPFPSDGDMLDFLLQTGEIEEKDGLYATWYHAANSKSEMSKALNSDVMILE ADVNVQGHNTVNETNIPIMAHPPDIYSDNTLEEWLDAVLKSKKGVKLDFKSISAVEPSLD LLRAKNQTGINRPVWINADILPGPNVPEFWPVVNASEFFELIQLKFPDVTISPGWKVLYL SIFPNVTYTRSMVEQMYSTIRHLPQKITFPVHALMAKNGWPHLSWLLSQSSRYSLTLWQG KENPTLNDLLFIRDNSNPQRIYYDIYEPVLSQFREAAKIKDRPRRFYPGGDIVDYFRPAD SDGLNIQWDTVNDKDSLLSLLEDSPGGMLVIPVKSSDGHPNIPIIDGSEMPLKDCLDLIL ASTKPWGIYLQIKSQNQLSLSLELLRQAYDIDLLHHPTWVNMDISHGAVHIQGYMTGEEF LRTVDRIFPHVTLAPSWPKEALVEGYTPEMLEPMVQLFHRAWQDVSLQLQAEALDRSETW RLVLVQPRFSLTVEHQTENKDINAGIESLMAIRAANRQRSFYNIPKMYREHITDLSVRK
Uniprot No.

Target Background

Database Links

KEGG: dre:100005645

UniGene: Dr.113821

Protein Families
FAM151 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of FAM151A protein in zebrafish?

FAM151A in zebrafish shares structural homology with its human counterpart, containing DUF2181 domains that belong to the GDPD/PLCD superfamily known to hydrolyze glycerophosphodiester bonds . The protein likely contains a transmembrane domain and two DUF2181 domains, similar to human FAM151A, with the second DUF2181 potentially being non-functional based on homology analysis . Functionally, FAM151A appears to be related to the menorin gene family, which is involved in dendrite branching and neuron development in other organisms . In zebrafish specifically, expression patterns suggest potential roles in kidney development and possibly retinal function, given the demonstrated importance of its paralog Fam151b in retinal physiology .

How is FAM151A expressed during zebrafish development?

While specific data on FAM151A expression in zebrafish development is limited in the provided search results, developmental expression patterns can be studied using techniques similar to those employed in other zebrafish gene studies. Temporal expression analysis would require sampling at different developmental stages (embryo, larval, juvenile, adult) followed by quantitative real-time PCR using appropriate reference genes such as ube2a and tmem50a, which have been identified as the most stable reference genes for developmental stage comparisons in zebrafish . Spatial expression can be mapped using in situ hybridization techniques. Based on mammalian data, researchers should particularly examine expression in kidney tubules, neural tissues, and potentially retinal structures .

What are the recommended reference genes when studying FAM151A expression in zebrafish?

When examining FAM151A expression across different experimental conditions in zebrafish, selecting appropriate reference genes is critical for accurate normalization of quantitative PCR data. According to comprehensive transcriptomic analyses:

  • For tissue-specific expression studies: sep15 and metap1 are the top two stable reference genes

  • For developmental stage comparisons: ube2a and tmem50a show the highest stability

  • For studies involving chemical treatments: rpl13a and rp1p0 demonstrate optimal stability

These reference genes should be used instead of conventional housekeeping genes (like eef1a1l1, b2m, hrpt1l and actb1), as they've been systematically validated to show better expression stability under specific experimental conditions in zebrafish .

What are the optimal methods for expressing recombinant zebrafish FAM151A protein?

Based on protocols for similar transmembrane proteins, recombinant FAM151A from zebrafish can be expressed using several systems:

  • Bacterial expression systems: While cost-effective, these may struggle with proper folding and post-translational modifications of complex proteins like FAM151A.

  • Mammalian cell systems: HEK293 or CHO cells typically produce better results for transmembrane proteins, allowing proper folding and post-translational modifications. For FAM151A, which contains multiple domains including a transmembrane segment, this system is preferable .

  • Insect cell systems: Baculovirus-infected insect cells provide an intermediate option between bacterial and mammalian systems.

The choice should be guided by the experimental requirements - structural studies may require higher purity but can tolerate some misfolding, while functional studies require properly folded protein. For FAM151A specifically, inclusion of the His-tag at the C-terminus rather than N-terminus may be preferable to avoid interference with the transmembrane domain .

How can zebrafish embryonic explants be used to study FAM151A function?

Zebrafish embryonic explants offer a valuable system to study the role of FAM151A in development. To implement this approach:

  • Prepare embryonic tissue explants prior to germ layer induction (approximately 4 hours post-fertilization)

  • Ensure polarized inheritance of maternal factors by careful selection of dorsal-marginal regions of the blastoderm

  • Culture explants under controlled conditions to observe germ layer specification

  • Apply morpholino knockdown or CRISPR-Cas9 targeting of fam151a to assess its role in tissue organization

  • Analyze patterns of gene expression and tissue organization

Importantly, these explants do not undergo complete self-organization but rather display features of genetically encoded self-assembly, where intrinsic genetic programs control the emergence of order . This makes them excellent models for studying the role of specific genes like fam151a in developmental processes.

How does zebrafish FAM151A compare functionally to its paralog FAM151B in retinal studies?

Recent research has demonstrated that Fam151b is essential for retinal function in mice, serving as a homologue of the C. elegans menorin gene . When designing comparative studies between FAM151A and FAM151B in zebrafish retinal development:

  • Knockout comparison: Generate both fam151a and fam151b knockout zebrafish lines using CRISPR-Cas9 to compare phenotypic effects on retinal development and function

  • Expression pattern analysis: Perform immunohistochemistry to map the specific cell types expressing each protein within retinal tissues

  • Functional complementation: Test whether overexpression of fam151a can rescue phenotypes in fam151b mutants, indicating functional redundancy

  • Protein interaction studies: Investigate whether both proteins interact with similar partners using co-immunoprecipitation or yeast two-hybrid screening

Current evidence suggests that while FAM151B has a confirmed role in retinal function , FAM151A's role may differ due to structural differences - notably FAM151A contains a transmembrane domain absent in FAM151B, suggesting potential functional divergence .

What stress-response pathways might interact with FAM151A in zebrafish models?

Investigating FAM151A in the context of stress responses in zebrafish requires consideration of multiple neurobiological pathways. Recent research on stress responses in zebrafish brains provides a framework for such studies:

  • Experimental design: Expose zebrafish to standardized stressors (food restriction, air exposure) as applied in stress trial protocols

  • Brain region specificity: Analyze FAM151A expression changes separately in telencephalon, mesencephalon, and rhombencephalon tissues

  • Sex-specific differences: Account for gender differences, as stress response gene expression patterns differ significantly between male and female zebrafish

  • Candidate pathway genes: Examine interactions with key stress response genes including:

    • Isotocin pathway genes (iso pre, iso-r2)

    • Metabolic regulators (mTOR)

    • Opioid receptors (opio d1a, opio d1b)

    • Serotonergic pathway components (tph)

  • Statistical approach: Apply principal component analyses and random forest modeling to classify gene expression patterns, as fewer than eight genes can provide accurate classification of stress responses

What are the methodological considerations for studying FAM151A's potential role in kidney development in zebrafish?

Based on human FAM151A's expression in kidney tubules , zebrafish models offer excellent opportunities to study its role in renal development:

  • Developmental time course: Track fam151a expression throughout pronephros development (24-96 hpf) using qRT-PCR and in situ hybridization

  • Genetic manipulation approaches:

    • Morpholino knockdown (transient)

    • CRISPR-Cas9 knockout (stable lines)

    • Conditional knockout using Gal4/UAS system with kidney-specific promoters

  • Functional assessments:

    • Structural analysis of pronephric ducts using confocal microscopy

    • Filtration capacity using fluorescent dextran clearance assays

    • Tubular function assessment using uptake of fluorescent organic anions

  • Rescue experiments: Attempt phenotype rescue with:

    • Wild-type zebrafish fam151a mRNA

    • Human FAM151A mRNA to test cross-species functional conservation

    • Mutant constructs lacking specific domains to map functional regions

  • Reference gene selection: For kidney-specific expression studies, use sep15 and metap1 as reference genes for qRT-PCR normalization

How can protein-protein interaction partners of zebrafish FAM151A be identified?

To identify interaction partners of zebrafish FAM151A, researchers should consider a multi-method approach:

  • Yeast two-hybrid screening:

    • Use the DUF2181 domains as bait

    • Create separate constructs for transmembrane and cytoplasmic regions

    • Screen against zebrafish cDNA libraries from tissues of interest (kidney, retina)

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged versions of FAM151A in zebrafish cells or tissues

    • Perform pull-down experiments followed by mass spectrometry identification

    • Validate identified interactions with reverse co-IP

  • Proximity labeling approaches:

    • Generate BioID or TurboID fusions with FAM151A

    • Express in zebrafish embryos or cell lines

    • Identify proteins that become biotinylated due to proximity

  • Bioinformatic prediction:

    • Based on knowledge that FAM151A is an ortholog of menorin , investigate potential conservation of known menorin interaction partners

    • Focus on proteins involved in dendrite branching pathways given the role of menorin in neuron development

Given FAM151A's transmembrane nature and involvement in the GDPD/PLCD superfamily , particular attention should be paid to membrane-associated proteins and those involved in phospholipid metabolism.

What are the critical quality control parameters for recombinant zebrafish FAM151A protein preparations?

When working with recombinant zebrafish FAM151A protein, rigorous quality control is essential:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (aim for >90% purity)

    • Western blot confirmation using anti-His antibodies or FAM151A-specific antibodies

    • Mass spectrometry verification of intact protein mass

  • Structural integrity validation:

    • Circular dichroism to confirm secondary structure content

    • Limited proteolysis to assess domain folding

    • Size exclusion chromatography to detect aggregation

  • Functional validation:

    • Enzymatic activity assays based on the protein's GDPD/PLCD superfamily membership

    • Test hydrolysis of glycerophosphodiester substrates

    • Membrane association assays if the transmembrane domain is included

  • Post-translational modification analysis:

    • Phosphorylation status

    • Glycosylation profile

    • Other potential modifications

  • Endotoxin testing:

    • Critical for proteins intended for in vivo experiments

    • Limulus amebocyte lysate (LAL) assay

    • Acceptable limit: <0.1 EU/μg protein

The expected molecular weight of zebrafish FAM151A should be approximately 95 kDa, similar to its human counterpart , though this may vary with tags and post-translational modifications.

How can zebrafish FAM151A studies inform human disease research?

Zebrafish FAM151A research has significant translational potential based on known human FAM151A associations:

  • Colorectal cancer models:

    • Human FAM151A contains SNP rs11206394, a significant predictor of colorectal cancer

    • Generate zebrafish with equivalent mutations using CRISPR-Cas9

    • Assess intestinal development and tumorigenesis in these models

  • Retinal degeneration investigations:

    • Given that FAM151B mutations cause retinal degeneration , examine whether FAM151A plays complementary or compensatory roles

    • Compare retinal phenotypes between fam151a and fam151b mutant lines

    • Assess potential for gene therapy approaches

  • Kidney disease models:

    • Human FAM151A is expressed in kidney tubules

    • Investigate zebrafish fam151a knockout effects on kidney function

    • Screen for kidney-specific phenotypes that might inform human kidney disease

  • Experimental design for translational studies:

    • Employ high-throughput behavioral and physiological screening

    • Use tissue-specific transgenic reporters to monitor affected organs

    • Develop zebrafish embryo drug screening platforms to identify compounds that modulate FAM151A function or rescue mutant phenotypes

What considerations are important when designing gene knockdown/knockout studies of FAM151A in zebrafish?

When designing genetic manipulation studies of FAM151A in zebrafish:

  • Choice of method:

    • Morpholinos: Suitable for rapid preliminary studies but prone to off-target effects

    • CRISPR-Cas9: Preferred for generating stable knockout lines

    • CRISPRi: Useful for temporal control of gene expression

  • Target site selection:

    • For morpholinos: Target splice junctions to facilitate validation by RT-PCR

    • For CRISPR-Cas9: Target early exons, particularly those encoding the transmembrane domain or first DUF2181 domain

    • Design multiple guide RNAs to increase knockout efficiency

  • Controls and validation:

    • Include appropriate controls (scrambled morpholinos or non-targeting gRNAs)

    • Rescue experiments with wild-type mRNA to confirm specificity

    • Validate knockout efficiency at protein level using western blot

  • Compensatory mechanisms:

    • Monitor potential upregulation of paralog fam151b as compensatory response

    • Consider generating double knockouts of fam151a and fam151b to overcome redundancy

    • Use conditional approaches to bypass early developmental requirements

  • Phenotypic analysis:

    • Comprehensive assessment at multiple developmental stages

    • Tissue-specific analyses focusing on kidney, retina, and neural tissues

    • Behavioral assays to detect subtle functional deficits

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.