Recombinant Danio rerio Protein FAM162B (fam162b)

What is FAM162B and what are its fundamental characteristics in zebrafish?

FAM162B (Family with sequence similarity 162 member B) in Danio rerio is a 155-amino acid protein with UniProt ID A3KP48. The complete amino acid sequence is: MFSMIRGPRAAFGTLIGQWRRGMMTTGNRRLCIKPQEGPSASPQTQRPGFKLPGYRPSDWDKKMLMWSGRFKTVEQIPEFVSFEMIDAARNRVRVKACYIMMGLTIFACLVMIVSGKKAVSRKESLIAINMEKKAKWREDAQREKEENALDAKAQ .

It appears to be a membrane-associated protein based on its sequence characteristics, particularly the transmembrane domain in the C-terminal region. While the precise function remains to be fully elucidated in zebrafish, studying this protein can provide insights into conserved functions across vertebrates.

How does zebrafish FAM162B compare structurally with human and mouse orthologs?

When comparing the zebrafish FAM162B protein with its human ortholog, several key differences are observed:

The human ortholog has a slightly longer sequence (162 aa vs. 155 aa) with the amino acid sequence: MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEIRHVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK . The central and C-terminal regions show higher conservation than the N-terminal region, suggesting functional importance of these domains.

What expression systems are optimal for producing functional recombinant Danio rerio FAM162B?

E. coli has been demonstrated as an effective expression system for producing recombinant zebrafish FAM162B . Methodology includes:

• Vector selection: Typically using vectors with strong inducible promoters (T7, tac)

• Strain optimization: BL21(DE3) or Rosetta strains are preferable for membrane proteins

• Expression conditions: Induction at lower temperatures (16-20°C) often yields better results for membrane-associated proteins

• Purification strategy:

  • Initial purification using affinity chromatography (His-tag binding to Ni-NTA)

  • Follow with size exclusion chromatography to remove aggregates

For studies requiring post-translational modifications or proper membrane insertion, consider alternative expression systems:

• Insect cells (baculovirus system)

• Yeast (Pichia pastoris)

• Mammalian cell lines

The choice depends on experimental requirements and downstream applications.

What are the recommended storage and handling conditions for recombinant FAM162B?

Optimal storage and handling conditions for recombinant FAM162B include:

• Storage buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Long-term storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use

• Working conditions: Store working aliquots at 4°C for up to one week

• Freeze-thaw cycles: Repeated freezing and thawing is not recommended

• Reconstitution: Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Glycerol addition: Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C

These conditions help maintain protein stability and functional integrity over time.

How can FAM162B be utilized in zebrafish models for studying potential roles in disease pathways?

Zebrafish FAM162B can be studied in disease contexts through several methodological approaches:

• Morpholino knockdown studies: Design antisense morpholinos targeting FAM162B to observe phenotypic effects during embryogenesis

• CRISPR/Cas9 gene editing: Generate stable knockout or knock-in lines to study long-term effects and potential disease phenotypes

• Overexpression studies: Inject mRNA encoding wild-type or mutated FAM162B to assess gain-of-function effects

• Reporter assays: Create fusion constructs with fluorescent proteins to track subcellular localization and tissue expression patterns

• Disease model integration: Since zebrafish are valuable models for human diseases , FAM162B function could be studied in contexts such as:

  • Cancer models, particularly myeloid leukemia where zebrafish has proven useful

  • Neurodegenerative disorders like Alzheimer's disease, where zebrafish models exist

  • Developmental disorders where membrane proteins play critical roles

The zebrafish model is particularly valuable due to its transparent embryos, rapid development, and genetic tractability .

What is known about the subcellular localization of FAM162B and how can it be determined experimentally?

Based on sequence analysis, FAM162B contains a transmembrane domain suggesting membrane localization, but specific experimental determination is recommended:

Methodological approaches for determining subcellular localization:

• Fluorescent protein fusion constructs: Creating N- or C-terminal fusions with GFP/mCherry for live imaging

• Subcellular fractionation and Western blotting:

  • Separate cellular components (cytosol, membrane, nucleus, etc.)

  • Detect FAM162B using specific antibodies or via His-tag

• Immunofluorescence microscopy:

  • Use anti-FAM162B antibodies or anti-tag antibodies

  • Co-stain with organelle markers (mitochondria, ER, Golgi)

• Electron microscopy with immunogold labeling: For high-resolution localization

• Protease protection assays: To determine membrane topology

These approaches can be applied in zebrafish cell lines or in vivo in embryos to understand the dynamic localization during development.

How does FAM162B expression change during zebrafish development, and what techniques can track these changes?

While specific developmental expression patterns of FAM162B in zebrafish aren't detailed in the provided search results, researchers can employ these methodological approaches:

• Quantitative RT-PCR: To measure transcript levels across developmental stages (zygote, blastula, gastrula, segmentation, pharyngula, hatching, larval)

• RNA-Seq analysis: For genome-wide expression profiling during development

  • This approach has been successfully used in proteomics studies of zebrafish development

• Whole-mount in situ hybridization (WISH): To visualize spatial expression patterns at different developmental stages

• Western blotting: To quantify protein levels at different stages using anti-FAM162B antibodies

• Transgenic reporter lines: Creation of fam162b:GFP reporter fish to visualize dynamic expression patterns in vivo

• Single-cell RNA-Seq: To identify cell populations expressing FAM162B during development

The zebrafish model is particularly valuable for developmental studies due to its external fertilization, transparent embryos, and rapid development .

What are common challenges in working with recombinant FAM162B and how can they be addressed?

Researchers may encounter several technical challenges when working with recombinant FAM162B:

• Protein solubility issues:

  • Challenge: As a transmembrane protein, FAM162B may form insoluble aggregates

  • Solution: Use mild detergents (0.1% DDM, 0.5% CHAPS) in extraction and purification buffers

  • Alternative: Express truncated versions lacking the transmembrane domain

• Low expression yield:

  • Challenge: Membrane proteins often express poorly in standard systems

  • Solution: Optimize codon usage for E. coli, reduce induction temperature to 16°C, or use specialized strains like C41(DE3)

• Protein degradation:

  • Challenge: Rapid degradation during expression or purification

  • Solution: Add protease inhibitors, reduce purification time, maintain samples at 4°C

• Improper folding:

  • Challenge: Recombinant protein may not adopt native conformation

  • Solution: Consider expression in eukaryotic systems or refolding protocols

• Tag interference:

  • Challenge: His-tag may affect protein function

  • Solution: Create both N- and C-terminal tagged versions, or include a cleavable tag

Maintaining proper buffer conditions (pH 8.0, 6% trehalose) and avoiding repeated freeze-thaw cycles can significantly improve protein stability.

How can the functional activity of recombinant FAM162B be verified in experimental systems?

To verify that recombinant FAM162B is functionally active, researchers can employ several complementary approaches:

• Structural integrity assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure

  • Thermal shift assays to evaluate protein stability

  • Size exclusion chromatography to detect proper oligomeric state

• Functional complementation:

  • Express recombinant FAM162B in zebrafish fam162b knockdown/knockout models

  • Assess rescue of any observed phenotypes

• Biochemical activity assays:

  • If membrane transport function is suspected, reconstitute in liposomes for transport assays

  • For potential enzymatic activity, develop specific substrate-based assays

• Protein-protein interaction verification:

  • Validate known interactions with binding partners

  • Use pull-down assays with cellular extracts to confirm interaction capabilities

• Cellular response monitoring:

  • Treat zebrafish cells with recombinant FAM162B (if secreted or taken up)

  • Monitor changes in signaling pathways potentially related to FAM162B function

Each verification method should include appropriate positive and negative controls to ensure reliable results.

How conserved is FAM162B across vertebrate species, and what does this suggest about its function?

Comparative analysis of FAM162B sequences across vertebrate species can provide valuable insights into its evolutionary conservation and potential function:

Methodological approaches for evolutionary analysis:

• Multiple sequence alignment: Align FAM162B sequences from diverse vertebrates to identify:

  • Highly conserved regions (potential functional domains)

  • Variable regions (species-specific adaptations)

  • Conservation of transmembrane domains

• Phylogenetic analysis: Construct evolutionary trees to understand:

  • Evolutionary relationships between FAM162B orthologs

  • Potential gene duplication events

  • Selection pressures acting on different regions

• Structural prediction: Use comparative modeling to predict:

  • Conservation of secondary structure elements

  • Potential ligand binding sites

  • Membrane insertion topology

The pattern of conservation suggests that FAM162B likely plays an important biological role that has been maintained throughout vertebrate evolution, with the highest conservation typically observed in the transmembrane regions and potential functional domains.

How does FAM162B relate to other FAM162 family members, and what experimental approaches can distinguish their functions?

FAM162B belongs to a protein family that includes FAM162A, which may have related but distinct functions:

Comparative characteristics:

Methodological approaches to distinguish their functions:

• Differential expression analysis:

  • Compare tissue/cell-specific expression patterns via RNA-Seq or qPCR

  • Analyze developmental timing of expression

  • Study expression under various stress conditions

• Protein-specific knockout/knockdown:

  • Generate specific knockouts for each family member

  • Compare phenotypes to identify unique vs. redundant functions

  • Rescue experiments with the other family member

• Domain-swapping experiments:

  • Create chimeric proteins exchanging domains between FAM162A and FAM162B

  • Identify domains responsible for specific functions or localizations

• Interactome analysis:

  • Compare binding partners using techniques like BioID or AP-MS

  • Identify shared vs. unique interaction networks

• Functional assays:

  • Assess effects on apoptosis, mitochondrial function, membrane integrity

  • Compare responses to various cellular stresses

Understanding the relationship between FAM162 family members can provide valuable insights into their evolved functions and potential redundancy in biological systems.

How might FAM162B function in zebrafish disease models, particularly in neurological or developmental contexts?

Zebrafish have emerged as valuable models for studying human diseases , suggesting several potential applications for FAM162B research:

• Neurodevelopmental roles:

  • Zebrafish are established models for studying neurological processes

  • Methodological approach: Track FAM162B expression during neural development using in situ hybridization

  • Experimental design: Create conditional knockouts to assess functions at different developmental stages

• Cancer biology applications:

  • Zebrafish models have been used for studying blood cancers like JMML

  • Research approach: Assess FAM162B expression changes in cancer models

  • Technique: Utilize single-cell transcriptomics as applied in zebrafish disease studies

• Vascular development:

  • If FAM162B is expressed in vascular tissues, it could be studied in the context of vascular development

  • Methodology: Combine FAM162B manipulations with existing vascular reporter lines (fli1:GFP)

• Response to hypoxia:

  • Zebrafish models have been used to study hypoxia responses

  • Experimental design: Compare FAM162B expression under normoxic vs. hypoxic conditions

  • Analysis: Determine if FAM162B is regulated similarly to hypoxia-responsive genes

• Functional genomics approach:

  • Create tissue-specific knockout models using CRISPR/Cas9

  • Perform comprehensive phenotyping (morphological, behavioral, physiological)

  • Integrate with other -omics data (transcriptomics, proteomics)

These research directions leverage the unique advantages of the zebrafish model system while exploring potential functional roles of FAM162B.

What high-throughput approaches can be used to identify potential functions of FAM162B in zebrafish?

Several high-throughput methodologies can accelerate functional discovery for FAM162B:

• CRISPR screening approaches:

  • Create a library of guide RNAs targeting potential FAM162B interactors

  • Screen for modifiers of FAM162B knockout phenotypes

  • Methodology: Use multiplexed CRISPR injections in embryos followed by phenotypic analysis

• Proteomics-based approaches:

  • Proximity labeling (BioID/APEX) to identify FAM162B protein interaction network

  • Quantitative proteomics to identify changes in FAM162B knockout/overexpression models

  • Methodology: Similar to approaches used in zebrafish proteomics studies on embryonic development

• Transcriptomics integration:

  • RNA-Seq analysis of FAM162B-deficient embryos/tissues

  • Single-cell RNA-Seq to identify cell populations affected by FAM162B manipulation

  • Methodology: Apply techniques used in zebrafish disease studies to understand transcriptional networks

• Chemical genetics:

  • Screen small molecule libraries for compounds that modify FAM162B-related phenotypes

  • Use in combination with FAM162B mutants to identify potential pathways

  • Methodology: Utilize zebrafish's amenability to chemical screening in multi-well formats

• Systems biology integration:

  • Integrate -omics data (transcriptomics, proteomics, metabolomics)

  • Apply network analysis to position FAM162B in biological pathways

  • Methodology: Weighted gene correlation network analysis (WGCNA) as applied in zebrafish development studies