Recombinant Danio rerio Protein FAM26E (fam26e)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
calhm5.1; fam26e; zgc:136947; Calcium homeostasis modulator protein 5; Protein FAM26E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
calhm5.1
Target Protein Sequence
MDSFKTVLKFFTDQKTTIGYSVMAILTIGSERIFSMVSFQCPCTKGQNFPYGICFLLGPA VVLLVVGFFVSTRFWRLYTGCCLNPLKLCPRGNFVGCLKGLIKVLYGACVAPVMWLTVAL LNGTFYECAVSGLDEVAVIQIFCADKGSVCQDELHRVPCGKSTLPPEQNTELLYMLRAQS QILGWSVIITAVVIALIGTCYKNCVSQVSYLQLTFWKIYMEKEREKFDAFANDYATKLAD RNLKSFFDNKLPEEFPFPNHKAWEEISAIYNFRKSEQHYSTLQRYVERSDRDYSPDEHPM VEMDHGIEMV
Uniprot No.

Target Background

Function
Pore-forming subunit of a voltage-gated ion channel.
Database Links

UniGene: Dr.118653

Protein Families
CALHM family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Protein FAM26E in zebrafish and why is it studied?

Protein FAM26E (UniProt: A4FUN9) is a protein expressed in Danio rerio (zebrafish) with a complete amino acid sequence of 310 residues. This protein belongs to the FAM26 family of proteins and is encoded by the fam26e gene (also known as zgc:136947) . Zebrafish serve as excellent model organisms for studying gene function due to their genetic similarity to humans, transparent embryos, high fecundity, and rapid development. Research into FAM26E helps understand its conservation across species, potential roles in developmental processes, and contributions to physiological functions in vertebrates.

The protein's amino acid sequence begins with MDSFKTVLKFFTDQKT and contains multiple transmembrane domains, suggesting potential roles in cellular communication or transport functions . Zebrafish are increasingly used as models for toxicology studies, making FAM26E potentially important for understanding gene-environment interactions.

How is the recombinant FAM26E protein typically produced and purified?

Recombinant FAM26E protein from zebrafish is typically produced using eukaryotic expression systems to ensure proper protein folding and post-translational modifications. While bacterial expression systems (E. coli) offer cost-effective production, they often struggle with proper folding of complex eukaryotic proteins. For FAM26E, yeast expression systems provide an excellent balance between production efficiency and proper protein conformation.

The production typically involves:

  • Gene cloning: The fam26e gene sequence is amplified from zebrafish cDNA and inserted into an appropriate expression vector containing a His-tag for purification.

  • Expression: The construct is transformed into the host organism (yeast being particularly effective for zebrafish proteins). As noted in comparable protein expression methods, "The yeast protein expression system is the most economical and efficient eukaryotic system for secretion and intracellular expression" .

  • Purification: The protein is typically purified using affinity chromatography (utilizing the His-tag), followed by size exclusion chromatography to achieve >90% purity .

  • Quality control: Verification of protein identity using mass spectrometry and functional testing via appropriate assays.

The resulting recombinant protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability .

What are the optimal storage conditions for recombinant FAM26E protein?

Optimal storage conditions for recombinant FAM26E protein are crucial for maintaining its structural integrity and biological activity. Based on standard protocols for similar zebrafish recombinant proteins, the following storage conditions are recommended:

  • Long-term storage: -20°C or -80°C in a Tris-based buffer containing 50% glycerol .

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles .

  • Avoid repeated freeze-thaw cycles as this can lead to protein denaturation and loss of activity .

When handling the protein:

  • Thaw frozen aliquots on ice

  • Mix gently by inversion rather than vortexing

  • Work with pre-chilled pipettes and tubes

  • Return to appropriate storage conditions immediately after use

The lyophilized form of the protein (if available) provides extended shelf-life and should be reconstituted according to manufacturer recommendations immediately before use .

How can FAM26E expression patterns be detected in zebrafish tissues?

Detection of FAM26E expression patterns in zebrafish tissues requires multiple complementary techniques to ensure reliable results:

  • RT-qPCR: For quantitative analysis of fam26e mRNA expression:

    • Extract RNA from specific tissues or developmental stages

    • Perform reverse transcription followed by quantitative PCR with fam26e-specific primers

    • Normalize to appropriate reference genes (e.g., ef1α, β-actin)

  • In situ hybridization: For spatial visualization of expression:

    • Generate antisense RNA probes against fam26e mRNA

    • Perform whole-mount in situ hybridization for embryos or section-based in situ for adult tissues

    • Include sense probes as negative controls

  • Immunohistochemistry: For protein-level detection:

    • Use validated antibodies against FAM26E (validate specificity with recombinant protein)

    • Perform on tissue sections or whole-mount for embryos

    • Include appropriate blocking and secondary antibody controls

  • Western blotting: For protein quantification:

    • Extract proteins from target tissues

    • Separate by SDS-PAGE and transfer to membrane

    • Probe with validated anti-FAM26E antibodies

This multi-modal approach provides comprehensive information about both transcriptional and translational expression patterns across tissues and developmental stages.

How can gene-environment interactions involving FAM26E be studied in zebrafish models?

Studying gene-environment interactions (GxE) involving FAM26E requires careful experimental design using the genetic diversity of zebrafish populations. Based on established methodologies in zebrafish research, the following approach is recommended:

  • Establish genetically diverse zebrafish populations:

    • Use outbred zebrafish lines to capture natural genetic variation

    • Consider utilizing the T5D population mentioned in research for toxicity assessments

    • Maintain multiple family lines (at least 12 pairs of adult zebrafish) to ensure genetic diversity

  • Design exposure experiments:

    • Expose embryos from different families to environmental factors of interest

    • Use standardized protocols similar to those established for PFHxA exposures (from 6 to 120 hpf)

    • Include appropriate controls and multiple concentrations of exposure agents

  • Measure behavioral and morphological outcomes:

    • Assess standard morphological endpoints at 24 hpf and 120 hpf

    • Conduct behavioral assays such as the larval photomotor response (LPR) test

    • Track movement patterns using specialized equipment like Zebrabox behavioral analysis chambers

  • Quantify FAM26E expression changes:

    • Perform RT-qPCR or RNA-Seq to measure fam26e expression changes across treatments and genetic backgrounds

    • Correlate expression changes with behavioral or morphological phenotypes

  • Statistical analysis to detect GxE effects:

    • Use mixed-effect modeling to apportion variation and assess significance of GxE terms

    • Calculate intraclass correlation (ICC) between full siblings from different families

    • Compare ICC values between control and exposure groups

This comprehensive approach allows researchers to determine if genetic background influences FAM26E-mediated responses to environmental exposures.

What techniques are recommended for studying FAM26E protein-protein interactions?

Investigating protein-protein interactions involving FAM26E requires multiple complementary approaches to build a reliable interaction network:

  • Yeast two-hybrid (Y2H) screening:

    • Use FAM26E as bait against zebrafish cDNA libraries

    • Validate positive interactions with targeted Y2H assays

    • Consider membrane-specific Y2H systems given FAM26E's predicted transmembrane domains

  • Co-immunoprecipitation (Co-IP) with recombinant FAM26E:

    • Perform pull-down assays using His-tagged recombinant FAM26E

    • Identify binding partners by mass spectrometry

    • Validate interactions with reciprocal Co-IP experiments

  • Proximity-dependent biotin identification (BioID):

    • Generate FAM26E-BioID fusion constructs for expression in zebrafish cells

    • Identify proteins that are biotinylated due to proximity to FAM26E

    • Validate with other interaction methods

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create fusion constructs of FAM26E and potential partners with split fluorescent protein fragments

    • Express in zebrafish embryos or cell culture

    • Visualize interactions through fluorescence microscopy

  • Surface Plasmon Resonance (SPR):

    • Use purified recombinant FAM26E protein (>90% purity)

    • Measure direct binding kinetics with potential interaction partners

    • Determine affinity constants and association/dissociation rates

This multi-method approach provides robust evidence for protein interactions while minimizing false positives inherent to any single method.

How can CRISPR-Cas9 be optimized for FAM26E functional studies in zebrafish?

CRISPR-Cas9 genome editing provides powerful tools for FAM26E functional studies in zebrafish. Here's an optimized methodology:

  • gRNA design for FAM26E targeting:

    • Design multiple gRNAs targeting different exons using zebrafish-specific tools

    • Prioritize sites with minimal predicted off-target effects

    • Consider targeting functional domains based on sequence analysis

    • Check for restriction sites near the cut site for genotyping purposes

  • Delivery method optimization:

    • Microinject Cas9 protein (not mRNA) with gRNAs into one-cell stage embryos

    • Standardize injection volumes and concentrations

    • Include phenol red in injection mix for visualization

    • Use tracrRNA:crRNA complexes for improved editing efficiency

  • Validation of editing efficiency:

    • Design PCR primers flanking the target site

    • Perform T7 Endonuclease I assay on pooled embryos at 24 hpf

    • Sequence PCR products from individual embryos to characterize mutations

    • Quantify mosaicism levels in F0 founders

  • Generation of stable lines:

    • Raise F0 mosaic fish to adulthood

    • Outcross to wild-type and screen F1 offspring for germline transmission

    • Sequence to identify carriers of frameshift mutations

    • Establish homozygous lines through F1 incrossing

  • Phenotypic characterization:

    • Apply standardized behavioral assays like the larval photomotor response test

    • Analyze responses to experimental stimuli

    • Compare phenotypes across different mutant lines to control for off-target effects

    • Perform rescue experiments with recombinant FAM26E protein

This comprehensive approach ensures reliable gene editing while minimizing off-target effects and providing thorough functional characterization.

What transcriptomic approaches are recommended for studying FAM26E-related pathways?

Transcriptomic analysis provides valuable insights into FAM26E-related pathways and functions. Based on successful approaches in zebrafish research, the following methodology is recommended:

  • Experimental design:

    • Compare wild-type, FAM26E knockdown, and FAM26E overexpression models

    • Include multiple biological replicates (minimum n=3 per condition)

    • Consider tissue-specific and temporal factors in sampling

    • Integrate environmental exposures to identify GxE effects

  • RNA isolation and quality control:

    • Extract RNA using TRIzol or RNeasy kits

    • Verify RNA integrity via Bioanalyzer (RIN > 8)

    • Quantify RNA concentration via fluorometric methods

    • Prepare separate pools for biological replicates

  • Library preparation and sequencing:

    • Prepare stranded mRNA libraries

    • Aim for 20-30 million paired-end reads per sample

    • Include spike-in controls for normalization

    • Sequence across multiple lanes to avoid batch effects

  • Data analysis pipeline:

    • Quality control with FastQC

    • Alignment to zebrafish genome (GRCz11)

    • Quantification using tools like featureCounts or Salmon

    • Differential expression analysis using DESeq2 or edgeR

  • Functional analysis:

    • Perform Gene Ontology enrichment analysis

    • Identify overrepresented pathways (similar to the approach used in RNAseq studies on zebrafish liver)

    • Construct gene co-expression networks

    • Validate key findings with RT-qPCR

This approach enables comprehensive characterization of transcriptional changes associated with FAM26E function, particularly in response to environmental factors.

How should researchers optimize ELISA assays using recombinant FAM26E protein?

Optimizing ELISA assays with recombinant FAM26E protein requires systematic parameter adjustments and careful validation:

  • Assay design selection:

    • Direct ELISA: Immobilize FAM26E protein directly on the plate

    • Sandwich ELISA: Use capture and detection antibodies specific to different FAM26E epitopes

    • Competitive ELISA: Best for measuring FAM26E in complex biological samples

  • Critical optimization parameters:

    • Coating buffer optimization (carbonate buffer pH 9.6 vs. PBS pH 7.4)

    • Blocking agent selection (BSA, milk, commercial blockers)

    • Antibody dilution optimization using checkerboard titration

    • Sample dilution determination

    • Incubation time and temperature optimization

  • Validation protocol:

    • Determine linear range using purified recombinant FAM26E

    • Calculate limit of detection (LoD) and limit of quantification (LoQ)

    • Assess inter- and intra-assay coefficient of variation (CV < 15%)

    • Perform spike-recovery experiments in sample matrix

    • Test for cross-reactivity with related proteins

  • Specialized considerations for FAM26E:

    • Use His-tag-based detection systems if His-tagged recombinant protein is used

    • Consider detecting native vs. denatured protein depending on epitope accessibility

    • Validate using zebrafish tissue lysates with known FAM26E expression levels

Following this systematic approach ensures development of a reliable, sensitive, and specific ELISA for FAM26E quantification in research applications.

What controls and validation methods are essential for FAM26E expression studies?

Rigorous controls and validation methods are essential for reliable FAM26E expression studies:

  • Essential experimental controls:

    • Positive control: Tissues known to express FAM26E (based on preliminary data)

    • Negative control: Tissues with minimal FAM26E expression

    • Technical controls: No-template controls for PCR, secondary-antibody-only controls for immunoassays

    • Knockout/knockdown controls: Samples with verified FAM26E inhibition

  • Validation across multiple methods:

    • Transcript level: RT-qPCR with multiple primer sets targeting different exons

    • Protein level: Western blot with antibodies targeting different epitopes

    • Localization: In situ hybridization and immunohistochemistry

    • Cross-validation: Compare results across all methods

  • Antibody validation framework:

    • Pre-absorption control: Pre-incubate antibody with recombinant FAM26E protein

    • Specificity testing: Verify single band of expected size via Western blot

    • Knockout validation: Confirm signal loss in FAM26E knockout/knockdown samples

    • Cross-reactivity assessment: Test against closely related proteins

  • RNA interference validation:

    • Use multiple siRNA/morpholino sequences targeting different regions

    • Include scrambled sequences as negative controls

    • Verify knockdown efficiency via RT-qPCR and Western blot

    • Perform rescue experiments with recombinant protein

This comprehensive validation approach ensures reliable and reproducible FAM26E expression data while minimizing artifacts and false results.

How can researchers assess the functional impact of FAM26E in zebrafish development?

Assessing FAM26E's functional impact on zebrafish development requires a multi-faceted approach combining genetic manipulation with phenotypic analysis:

  • Temporal expression profiling:

    • Perform RT-qPCR analysis of fam26e expression at key developmental stages (6, 24, 48, 72, 96, 120 hpf)

    • Conduct whole-mount in situ hybridization to map spatial expression patterns

    • Correlate expression with critical developmental milestones

  • Loss-of-function approaches:

    • Generate CRISPR-Cas9 knockout lines

    • Design antisense morpholinos targeting translation start site or splice junctions

    • Validate knockdown efficiency at protein level via Western blot

  • Comprehensive phenotypic assessment:

    • Morphological screening: Assess standard endpoints at 24 hpf and 120 hpf as described in zebrafish toxicology studies

    • Behavioral analysis: Conduct standardized tests like the larval photomotor response assay

    • Tissue-specific assessment: Examine development of specific organs based on expression patterns

  • Gain-of-function approaches:

    • Microinject FAM26E mRNA at one-cell stage

    • Create transgenic lines with tissue-specific FAM26E overexpression

    • Administer recombinant FAM26E protein (if cell-permeable or receptor-mediated)

  • Gene-environment interaction studies:

    • Expose FAM26E-modified and control embryos to environmental stressors

    • Measure differential susceptibility similar to PFHxA exposure studies

    • Calculate intraclass correlation (ICC) between siblings to quantify genetic effects

This systematic approach provides comprehensive insights into FAM26E's developmental functions while establishing causal relationships between gene function and phenotypic outcomes.

What are the recommended approaches for studying post-translational modifications of FAM26E?

Post-translational modifications (PTMs) of FAM26E can significantly influence its function and localization. The following methodological approaches are recommended:

  • Computational prediction of potential PTMs:

    • Use bioinformatic tools to predict potential phosphorylation, glycosylation, and other modification sites

    • Compare predictions across species for evolutionary conservation

    • Prioritize sites with high prediction scores or conservation

  • Mass spectrometry-based identification:

    • Immunoprecipitate FAM26E from zebrafish tissues or cell lysates

    • Perform tryptic digestion followed by LC-MS/MS analysis

    • Use both collision-induced dissociation (CID) and electron-transfer dissociation (ETD) fragmentation

    • Apply enrichment strategies for specific modifications (e.g., TiO₂ for phosphopeptides)

  • Site-directed mutagenesis validation:

    • Generate FAM26E constructs with mutations at predicted PTM sites

    • Express in zebrafish embryos or cell culture

    • Compare localization, stability, and function with wild-type protein

  • PTM-specific antibodies:

    • Generate or source antibodies against specific FAM26E modifications

    • Validate specificity using appropriate controls

    • Apply in Western blot and immunohistochemistry

  • Modification dynamics:

    • Study changes in PTM patterns during development

    • Investigate effects of environmental stressors on modification status

    • Compare PTM patterns across different tissues

This comprehensive approach enables detailed characterization of FAM26E post-translational modifications and their functional significance in zebrafish development and physiology.

How can recombinant FAM26E be used in protein interaction screening assays?

Recombinant FAM26E protein can be leveraged for multiple protein interaction screening approaches:

  • Protein microarray screening:

    • Immobilize recombinant FAM26E (>90% purity) on array surfaces

    • Probe with fluorescently labeled zebrafish tissue extracts

    • Identify binding partners through fluorescence detection

    • Validate hits with independent methods

  • Pull-down assays with immobilized FAM26E:

    • Couple purified His-tagged FAM26E to Ni-NTA or similar affinity resin

    • Incubate with zebrafish tissue lysates under varying conditions

    • Elute bound proteins and identify via mass spectrometry

    • Include appropriate negative controls (unrelated proteins with same tag)

  • Surface Plasmon Resonance (SPR) screening:

    • Immobilize FAM26E on sensor chips

    • Flow candidate interacting proteins over the surface

    • Measure binding kinetics and affinity constants

    • Perform competition assays to identify binding sites

  • AlphaScreen/AlphaLISA assays:

    • Couple FAM26E to donor beads and potential partners to acceptor beads

    • Measure proximity-induced signal upon interaction

    • Screen libraries of candidate proteins

    • Optimize buffer conditions to reduce false positives

  • Crosslinking-Mass Spectrometry (XL-MS):

    • Incubate recombinant FAM26E with potential binding partners

    • Apply chemical crosslinkers to stabilize interactions

    • Digest and analyze by mass spectrometry

    • Identify interaction interfaces through crosslinked peptides

These complementary approaches provide a comprehensive strategy for identifying and characterizing FAM26E protein interactions, which is crucial for understanding its biological functions.

How do behavioral assays help characterize FAM26E function in zebrafish models?

Behavioral assays provide powerful phenotypic readouts for characterizing FAM26E function in zebrafish. The larval photomotor response (LPR) assay is particularly valuable:

  • Standardized LPR protocol:

    • Equipment: Zebrabox behavioral analysis chambers (ViewPoint Behavior Technologies)

    • Age: 120 hours post fertilization (hpf)

    • Assay duration: 24 minutes total

    • Light conditions: 4 cycles of 3 minutes light followed by 3 minutes dark

    • Data collection: Movement tracking with motion analysis software

    • Measurement: Total distance moved during dark phase

  • Behavioral phenotyping advantages:

    • Non-invasive assessment

    • High-throughput capability

    • Sensitive to subtle neurological phenotypes

    • Quantifiable using standardized metrics

    • Allows for population-level genetic analysis

  • Data analysis approach:

    • Custom R scripts for movement quantification

    • Mixed-effect modeling to assess gene-environment interactions

    • Calculation of intraclass correlation (ICC) between siblings

    • Comparison of variance components between treatment groups

  • Application to FAM26E studies:

    • Compare behavioral profiles between FAM26E knockdown/knockout and controls

    • Assess if FAM26E modification alters response to environmental stressors

    • Determine if genetic background influences FAM26E-related behavioral phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.