Recombinant Danio rerio Protein FAM73A (fam73a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
miga1; fam73a; zgc:101625; Mitoguardin 1; Protein FAM73A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
miga1
Target Protein Sequence
MNEDVLRSSHLPIKLAALHFLDLPLSVYYSLPQVSLSTGTKKLFAATAFGAVSLIIIARR FRRRKGRRKANSPVEQETFEFLTTIHLSKESDSQSVPQNSENPYTCNVVSGALYNKLSGS LPSLVSVRSRHSSSSSTCANGSNCWEEAGDAADVCNLLSLPVATPENLYLMGMELFEEAL RRWEQALTFRSRQAEDEGSCVSVKLGAGDAIAEESMEDIISADFIQKLESLLQRAYRLQE EFEGSLGVTDPTTHPTNVLLADKHMDLSVREELEDTCLRDSISIASTDSFVSAAELSEHR EMRSGHALGSLSPHPFYEDALQMAEEGKISCRVLRTEMLECLGDADFLAKLHCVRQACQV ILCERATRAFLADTGKRILSAIIAKARKSPKRFEEVFEEMISFLEHTDHWENTENELSSR GVKHMNFYDVVLDFILMDSFEDLENPPLSIQTVVNNRWLSNSFKETAVASSCWSVLKQKR QHMKVQDGFIAHFYAVCEHISPVLAWGFLGPKCTLQDFCCFFKEQVLFFLKDIFDLDKVR YFSLETLAEDILHLLHRRSDLLMAYLATDVIHHLNGCSDTSVHLVHSALLEAQVQ
Uniprot No.

Target Background

Function

Function: Recombinant Danio rerio Protein FAM73A (fam73a) is a regulator of mitochondrial fusion. It functions by forming homo- and heterodimers at the mitochondrial outer membrane, facilitating the formation of pld6/MitoPLD dimers. It may regulate phospholipid metabolism through pld6/MitoPLD interaction.

Database Links

KEGG: dre:450070

UniGene: Dr.683

Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of Protein FAM73A in Danio rerio?

Protein FAM73A (fam73a) is a novel protein identified in Danio rerio, commonly known as zebrafish. Zebrafish are widely used as model organisms in molecular biology due to their genetic similarity to humans and their transparent embryonic development. FAM73A has been implicated in various cellular processes, including mitochondrial localization and potential roles in signaling pathways such as Wnt signaling . This protein's biological significance lies in its association with fundamental cellular mechanisms, making it a subject of interest for studies on protein interactions, signaling cascades, and mitochondrial function.

Experimental evidence suggests that FAM73A interacts dynamically with other proteins depending on cellular stimuli. For example, studies using triple SILAC-based dynamic interaction screens have identified FAM73A as a component of the Wnt signaling pathway, linking it to key cellular functions like proliferation and differentiation . Understanding its role in zebrafish can provide insights into conserved biological processes relevant to human health.

How can researchers design experiments to study the localization of FAM73A within cells?

The localization of FAM73A within cells can be studied using advanced microscopy techniques combined with molecular tagging strategies. For instance, generating a GFP-BAC line for FAM73A allows visualization of its subcellular distribution through fluorescence microscopy . This approach has revealed mitochondrial localization for FAM73A, suggesting its involvement in energy metabolism and organelle-specific functions.

To design experiments:

  • Tagging: Clone the fam73a gene into a vector containing a fluorescent tag such as GFP or mCherry. Ensure that the tag does not interfere with the protein's native function.

  • Transfection: Introduce the tagged construct into zebrafish cells or embryos using electroporation or microinjection.

  • Microscopy: Use confocal or live-cell imaging techniques to observe the tagged protein's localization under different conditions.

  • Validation: Confirm mitochondrial association by co-staining with mitochondrial markers (e.g., MitoTracker dyes) and performing colocalization analysis.

These experiments can be complemented by biochemical methods such as subcellular fractionation followed by Western blotting to validate microscopy findings.

What are the challenges in studying protein-protein interactions involving FAM73A?

Studying protein-protein interactions involving FAM73A presents several challenges:

  • Dynamic Interactions: FAM73A exhibits stimulus-specific binding patterns, complicating static interaction studies . Researchers must account for temporal changes in interaction networks.

  • False Positives: Non-specific binding during pull-down assays can lead to false-positive results. Label-swapping experiments and stringent statistical thresholds are essential to minimize errors .

  • Low Abundance: The endogenous levels of FAM73A may be low, requiring sensitive detection methods such as SILAC or quantitative mass spectrometry.

  • Complex Networks: Interaction networks involving FAM73A are often intricate, involving multiple pathways like Wnt signaling. Computational tools such as Ingenuity Pathway Analysis® can help decipher these networks .

To overcome these challenges, researchers should use dynamic interaction screens like triple SILAC combined with robust statistical analyses to identify specific interactors under different experimental conditions.

How does recombinant production of FAM73A facilitate research?

Recombinant production of FAM73A enables researchers to obtain sufficient quantities of purified protein for biochemical and structural studies. Recombinant proteins are produced by expressing the target gene in heterologous systems such as Escherichia coli or mammalian cells, followed by purification using affinity chromatography.

For recombinant FAM73A:

  • Expression Systems: Choose an expression system optimized for zebrafish proteins, ensuring proper folding and post-translational modifications.

  • Purification Tags: Use tags like His-tag or GST-tag for efficient purification without compromising protein activity .

  • Storage Conditions: Store purified protein at -20°C or -80°C in Tris-based buffers containing glycerol to maintain stability .

Recombinant production facilitates functional assays (e.g., enzymatic activity), structural studies (e.g., X-ray crystallography), and interaction analyses (e.g., pull-down assays).

What methodologies are available for studying stimulus-specific interactions of FAM73A?

Stimulus-specific interactions of FAM73A can be studied using advanced proteomic techniques such as triple SILAC (Stable Isotope Labeling by Amino Acids in Cell Culture). This method involves labeling proteins with isotopically distinct amino acids under different conditions to compare their binding profiles dynamically .

Steps include:

  • Labeling: Culture zebrafish cells with isotopically labeled amino acids under control and stimulated conditions.

  • Pull-Down Assays: Use bait proteins such as APC (adenomatous polyposis coli) to isolate interacting partners.

  • Mass Spectrometry: Analyze labeled proteins using high-resolution mass spectrometry to quantify binding changes.

  • Data Analysis: Apply statistical methods like box plot analysis and volcano plots to identify significant interactors .

This approach is particularly effective for studying how cellular stimuli like Wnt activation influence FAM73A's interactions.

Can computational tools predict functional roles for FAM73A?

Yes, computational tools can predict functional roles for FAM73A based on its sequence, structure, and interaction networks:

  • Sequence Analysis: Tools like BLAST can identify homologous proteins across species, providing clues about conserved functions.

  • Structural Modeling: Software like SWISS-MODEL can generate 3D models of FAM73A based on known structures, aiding in functional predictions.

  • Pathway Analysis: Ingenuity Pathway Analysis® integrates experimental data with predicted interactions to map FAM73A's roles within cellular pathways .

Combining computational predictions with experimental validation ensures accurate functional characterization.

How can contradictory data regarding FAM73A's function be resolved?

Resolving contradictory data requires careful experimental design and robust statistical analysis:

  • Replication Studies: Conduct independent experiments under identical conditions to verify findings.

  • Controls: Include positive and negative controls to validate assay specificity.

  • Meta-Analysis: Integrate data from multiple studies using meta-analysis techniques to identify consistent trends.

  • Advanced Statistics: Apply rigorous statistical methods (e.g., Benjamini-Hochberg correction) to minimize false positives .

Transparency in reporting experimental conditions and results is crucial for resolving contradictions.

What are the potential applications of studying FAM73A in zebrafish?

Studying FAM73A in zebrafish has several applications:

  • Developmental Biology: Investigating its role during embryogenesis can provide insights into conserved developmental processes.

  • Disease Modeling: Zebrafish models expressing mutant forms of fam73a can mimic human diseases associated with mitochondrial dysfunction.

  • Drug Screening: Identifying pathways involving FAM73A enables targeted drug screening for conditions like cancer or neurodegeneration.

These applications highlight the translational potential of zebrafish research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.