FAM73B belongs to the FAM73 family of proteins, with the zebrafish ortholog sharing functional and structural similarities to its human counterpart. Key identifiers include:
The protein’s amino acid sequence (MSFRSAEGVSIMQALAMTVAEIPVFLYSTFGQSIFSQLKLSPSLKKVLFATALGSVALAL...) includes conserved motifs associated with mitochondrial regulation, though specific functional domains remain under investigation.
Recombinant FAM73B is synthesized in E. coli and purified using affinity chromatography (e.g., nickel or cobalt columns for His-tagged variants) . Key production parameters include:
The protein’s biochemical profile is defined by its recombinant origin and purification strategy:
No enzymatic activity or substrate specificity data are currently available in public databases or product specifications .
Current literature focuses on product characterization rather than functional analysis. Critical gaps include:
Mechanistic Insights: Determining FAM73B’s role in mitochondrial biogenesis, apoptosis, or stress responses.
Cross-Species Validity: Comparing zebrafish FAM73B to human MIGA2 in functional assays.
Disease Models: Exploring its relevance to mitochondrial disorders or neurodegenerative diseases.
KEGG: dre:541431
UniGene: Dr.38403
FAM73B (Family with sequence similarity 73 member B) is a mitochondrial outer membrane protein in zebrafish that regulates mitochondrial morphology. While the core function of controlling mitochondrial dynamics appears conserved across vertebrates, zebrafish FAM73B (also referred to as MIGA2) functions primarily in regulating the switch from mitochondrial fusion to fission. In zebrafish as in mammals, FAM73B ablation promotes mitochondrial fission and subsequently alters immune cell function, particularly in macrophages and dendritic cells .
The protein exhibits functional conservation with mammalian orthologs, as demonstrated by similar phenotypic outcomes when the gene is deleted in mouse models. Both systems show enhanced IL-12 production and anti-tumor immune responses when FAM73B is absent .
Based on the available research, FAM73B contains functional domains that anchor it to the mitochondrial outer membrane, allowing it to mediate mitochondrial dynamics. While the search results don't detail specific domains, the protein's localization to the mitochondrial membrane is essential for its role in regulating morphological transitions between fusion and fission states .
The functional importance of this localization is demonstrated by experiments showing that deletion of FAM73B leads to severe mitochondrial fragmentation, indicating its role in maintaining normal mitochondrial network structure .
While the current search results don't specifically address FAM73B developmental expression patterns in zebrafish, research on related FAM family proteins in zebrafish provides some insights. For example, FAM83F shows developmental stage-specific expression, particularly in hatching gland tissues of developing embryos .
By analogy, FAM73B likely exhibits tissue-specific and developmental stage-specific expression patterns that correspond to its functions in mitochondrial dynamics and immune system development. Research examining expression patterns using techniques similar to those applied for FAM83F (including in situ hybridization and developmental transcriptomics) would be valuable for understanding FAM73B's developmental regulation .
CRISPR/Cas9 genome editing represents the most effective approach for generating FAM73B knockout zebrafish. Based on methodologies described for related studies, researchers should:
Design sgRNAs using tools like CHOPCHOP with the GRCz10 assembly and default search parameters
Select sgRNAs based on their predicted efficiency and lack of off-target effects
Assemble sgRNAs with Cas9 protein into ribonucleoprotein complexes
Microinject these complexes into one-cell stage zebrafish embryos
Screen F0 fish for mutations and establish stable knockout lines through selective breeding
For confirmation of knockout, genotyping using PCR and sequencing of the target region is essential, followed by functional validation through assessment of mitochondrial morphology and immune phenotypes .
To effectively study FAM73B-mediated mitochondrial dynamics in zebrafish cells, researchers should utilize the following methodological approaches:
Live imaging of mitochondrial morphology using fluorescent mitochondrial markers (such as MitoTracker dyes) in wild-type versus FAM73B knockout cells
Confocal microscopy with Z-stack imaging using a setup similar to that described in the literature: "a Zeiss inverted Axio Observer LSM 710 confocal microscope, using the 405, 543 and 639 nm laser lines to capture Z stack images"
Quantitative assessment of mitochondrial network parameters (length, interconnectivity, fragmentation)
Analysis of mitochondrial function using respirometry and membrane potential measurements
Comparison of mitochondrial dynamics before and after cellular stressors or immune stimulation
These approaches allow for detailed characterization of how FAM73B influences mitochondrial network structure and function under various physiological conditions.
For expressing and purifying functional recombinant zebrafish FAM73B:
Clone the FAM73B coding sequence into a bacterial expression vector with appropriate affinity tags
Express in E. coli using a system optimized for membrane proteins, such as BL21(DE3) with specialized helper plasmids
Consider using detergent solubilization methods appropriate for mitochondrial membrane proteins
Purify using affinity chromatography followed by size exclusion chromatography
Verify protein quality through SDS-PAGE, Western blotting, and functional assays
As FAM73B is a mitochondrial membrane protein, special attention must be paid to maintaining its native conformation during purification. Approaches used for other membrane proteins, such as inclusion of appropriate lipids or detergents during purification, may enhance stability and functionality .
FAM73B controls macrophage polarization through its effects on mitochondrial dynamics, which subsequently regulate immune signaling pathways. Specifically:
FAM73B regulates the switch from mitochondrial fusion to fission in response to Toll-like receptor (TLR) activation
Ablation of FAM73B (Miga2) promotes mitochondrial fission, which enhances production of IL-12 while inhibiting IL-10 and IL-23 expression
This cytokine profile shift promotes Th1-type immune responses
The mechanism involves altered Parkin recruitment to mitochondria, which affects the CHIP-IRF1 signaling axis
The research demonstrates that "myeloid cell but not T cell conditional knockout mice have enhanced Th1 responses," indicating the specificity of this regulatory pathway to myeloid lineage cells such as macrophages and dendritic cells .
To assess FAM73B's influence on anti-tumor immunity, researchers can employ these methodological approaches:
Tumor challenge models: Inoculate FAM73B knockout and wild-type zebrafish or mice with compatible tumor cells (e.g., melanoma cells in mice) and monitor:
Tumor growth rates
Survival curves
Tumor-infiltrating immune cell profiles
Immune response analysis:
Mechanistic validation:
Studies have shown that "FAM73B deletion profoundly suppressed tumor growth and increased the survival rate of tumor-bearing mice," making this a promising area for therapeutic development .
FAM73B regulates mitochondrial morphology through a complex molecular mechanism:
Under normal conditions, FAM73B promotes or maintains mitochondrial fusion
Upon TLR activation, a switch from fusion to fission occurs
FAM73B depletion causes "severe mitochondrial fragmentation," indicating its role in preventing excessive fission
Unlike other mitochondrial fusion regulators (Mfn1/Mfn2), FAM73B appears to function through a distinct mechanism, as "Mfns are dispensable for the mitochondrial morphology switch under polarization stress"
These findings suggest FAM73B operates through a novel pathway to maintain mitochondrial network integrity, potentially by regulating the activity or localization of fission/fusion machinery components .
The FAM73B-Parkin-IRF1 signaling axis operates through the following mechanism:
Mitochondrial fission (promoted by FAM73B ablation) enhances Parkin expression and recruitment to mitochondria
Recruited Parkin induces degradation of monoubiquitinated CHIP (C-terminus of HSC70-interacting protein)
CHIP degradation stabilizes IRF1 (Interferon Regulatory Factor 1), a key transcription factor
Stabilized IRF1 promotes transcription of IL-12 and other pro-inflammatory genes
This signaling cascade ultimately enhances Th1-type immune responses and anti-tumor immunity
This pathway represents a previously unappreciated link between mitochondrial dynamics and immune signaling, highlighting how changes in organelle morphology can directly impact transcriptional programs in immune cells .
To comprehensively map FAM73B protein interactions:
BioID or proximity labeling approaches:
Express FAM73B fused to a promiscuous biotin ligase (BirA*) in zebrafish cells
Identify proteins in proximity to FAM73B through streptavidin pulldown and mass spectrometry
Co-immunoprecipitation coupled with mass spectrometry:
Generate antibodies against zebrafish FAM73B or use epitope-tagged versions
Perform immunoprecipitation under conditions that preserve native interactions
Identify binding partners through proteomics
In vitro binding assays:
Yeast two-hybrid or mammalian two-hybrid screening:
These approaches would help identify novel FAM73B interactors beyond the known relationships with mitochondrial dynamics and Parkin signaling pathways.
While the search results don't specifically address this comparison, addressing differential effects would involve:
Generating both null mutations (complete knockout) and specific domain mutations in FAM73B
Comparing phenotypes:
Complete knockout likely produces maximal mitochondrial fragmentation and enhanced IL-12 production
Domain-specific mutations may reveal more nuanced functions, potentially separating mitochondrial and immune regulatory roles
Dose-dependent effects:
Heterozygous versus homozygous knockout comparisons
Conditional or inducible knockout systems to study temporal requirements
Rescue experiments:
This approach would provide insights into structure-function relationships and potentially identify domains that could be selectively targeted for therapeutic purposes.
For identifying small molecule modulators of FAM73B:
Primary screening assays:
Develop zebrafish reporter lines that visualize mitochondrial morphology (e.g., fluorescent mitochondrial markers)
Screen compound libraries for molecules that phenocopy FAM73B knockout or rescue FAM73B deficiency
Utilize the advantages of zebrafish for "high-throughput drug screening" due to their small size and transparency
Secondary validation:
Confirm direct binding to FAM73B using thermal shift assays or surface plasmon resonance
Validate effects on mitochondrial dynamics in isolated cells
Test effects on IL-12 production and immune cell function
Mechanistic studies:
Determine if identified compounds affect FAM73B expression, localization, or protein-protein interactions
Assess effects on the Parkin-CHIP-IRF1 axis
In vivo validation:
This approach could identify therapeutic candidates that modulate mitochondrial dynamics and immune responses for applications in cancer immunotherapy.
The conservation of FAM73B function across vertebrates appears substantial based on current research:
Functional conservation:
Structural conservation:
The mitochondrial outer membrane localization is maintained across species
The ability to influence mitochondrial morphology is preserved from fish to mammals
Regulatory conservation:
This high degree of conservation suggests that insights gained from zebrafish models of FAM73B function can provide valuable information relevant to human biology and disease.
Zebrafish offer several distinct advantages for studying FAM73B function:
Developmental accessibility:
External fertilization and development allow for direct observation of mitochondrial dynamics during embryogenesis
Transparency of embryos facilitates real-time imaging of mitochondrial morphology in intact organisms
Genetic tractability:
Efficient genome editing using CRISPR/Cas9 as demonstrated in the literature
Ability to generate transgenic reporter lines for visualizing mitochondrial dynamics
High-throughput capabilities:
Zebrafish larvae are amenable to automated imaging and phenotypic analysis
Drug screening can be performed in a whole-organism context
Comparative insights:
These advantages make zebrafish an excellent complementary model to mammalian systems for comprehensive understanding of FAM73B biology.
The research suggests significant potential for targeting FAM73B in cancer immunotherapy:
Mechanism-based rationale:
Potential therapeutic strategies:
Small molecule inhibitors of FAM73B function
Genetic approaches to modulate FAM73B expression in tumor-associated macrophages
Combination approaches with existing immunotherapies
Target validation:
The authors specifically conclude that "mechanisms associated with mitochondrial dynamics control anti-tumor immune responses and that are potential targets for cancer immunotherapy," highlighting the translational potential of this research .
While not directly addressed in the search results, the role of FAM73B in mitochondrial dynamics suggests potential contributions to mitochondrial disease:
Potential pathogenic mechanisms:
Disruption of mitochondrial network homeostasis
Altered mitochondrial quality control through disrupted Parkin recruitment
Imbalanced mitochondrial fusion/fission leading to bioenergetic defects
Immune dysregulation:
Altered cytokine production could contribute to inflammatory manifestations of mitochondrial diseases
Dysregulated macrophage function might impact tissue homeostasis
Cellular stress responses:
Further research specifically examining FAM73B in mitochondrial disease models would help clarify these potential connections and identify therapeutic opportunities.
Generating effective antibodies against zebrafish FAM73B presents several challenges:
Primary challenges:
Limited commercial availability of zebrafish-specific antibodies
Potential low endogenous expression levels, as suggested by research on related proteins: "Fam83fa protein is itself targeted to the lysosome, making it difficult to detect at the endogenous level"
Cross-reactivity concerns with other mitochondrial membrane proteins
Recommended solutions:
Generate peptide antibodies against unique regions of zebrafish FAM73B
Produce recombinant fragments for immunization, focusing on non-membrane domains
Validate specificity using FAM73B knockout tissues as negative controls
Consider epitope tagging approaches (HA, FLAG, etc.) as alternatives to detecting endogenous protein
Validation strategies:
These approaches would help overcome the technical barriers to studying endogenous FAM73B in zebrafish systems.
To effectively measure mitochondrial dynamics in live zebrafish:
Transgenic reporter lines:
Generate lines expressing mitochondrially-targeted fluorescent proteins (e.g., mito-GFP, mito-DsRed)
Create FAM73B knockout or conditional lines with these reporters
Develop dual-color systems to visualize both fusion and fission events
Live imaging techniques:
Confocal microscopy of specific tissues in embryos/larvae
Light-sheet microscopy for whole-organism imaging
Time-lapse imaging to capture dynamic changes in mitochondrial morphology
Quantitative analysis:
Develop automated image analysis pipelines to quantify parameters such as:
Mitochondrial length, area, and circularity
Network connectivity and branching
Fusion and fission rates
Perturbation approaches:
These approaches would provide comprehensive insights into how FAM73B regulates mitochondrial dynamics in vivo in the context of a whole organism.
Several important aspects of FAM73B biology remain to be explored:
Investigation of these aspects would provide a more comprehensive understanding of FAM73B biology beyond its established roles in mitochondrial dynamics and immune function.
To systematically investigate FAM73B interactions with other mitochondrial dynamics regulators:
Genetic interaction studies:
Generate compound mutants of FAM73B with other fusion/fission regulators (e.g., Drp1, Mfn1/2, Opa1)
Perform genetic epistasis analysis to determine pathway relationships
Use CRISPR screening approaches to identify synthetic lethal or suppressor interactions
Proteomic approaches:
Conduct comparative proteomics of mitochondria from wild-type versus FAM73B knockout zebrafish
Perform temporal analysis of protein interactions during fusion/fission transitions
Apply proximity labeling to identify context-specific interaction partners
High-resolution imaging:
Use super-resolution microscopy to visualize co-localization with other dynamics regulators
Implement live-cell imaging to track temporal relationships during morphology changes
Systems biology approaches:
These approaches would clarify how FAM73B functions within the broader context of mitochondrial dynamics regulation and identify key nodes for potential therapeutic intervention.