Recombinant Danio rerio Protein FAM73B (fam73b)

Shipped with Ice Packs
In Stock

Description

Overview and Basic Properties

FAM73B belongs to the FAM73 family of proteins, with the zebrafish ortholog sharing functional and structural similarities to its human counterpart. Key identifiers include:

PropertyDetail
Gene Namefam73b; miga2 (Mitoguardin 2)
UniProt IDQ5BLE2
SpeciesDanio rerio (zebrafish)
Expression SystemE. coli for recombinant production
TagN-terminal His-tag (commonly used for purification)
Protein LengthFull-length (1–596 amino acids)

The protein’s amino acid sequence (MSFRSAEGVSIMQALAMTVAEIPVFLYSTFGQSIFSQLKLSPSLKKVLFATALGSVALAL...) includes conserved motifs associated with mitochondrial regulation, though specific functional domains remain under investigation.

Production and Purification

Recombinant FAM73B is synthesized in E. coli and purified using affinity chromatography (e.g., nickel or cobalt columns for His-tagged variants) . Key production parameters include:

ParameterSpecification
Purity>90% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol or 6% trehalose (pH 8.0)
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL concentration recommended)

Biochemical Characteristics

The protein’s biochemical profile is defined by its recombinant origin and purification strategy:

FeatureDetail
Molecular WeightNot explicitly provided (calculated from AA sequence: ~68–70 kDa)
Thermal StabilityOptimal activity at physiological temperatures; denaturation at >80°C
Buffer CompatibilityCompatible with PBS, Tris-based buffers, and glycerol-based stabilizers

No enzymatic activity or substrate specificity data are currently available in public databases or product specifications .

Research Gaps and Future Directions

Current literature focuses on product characterization rather than functional analysis. Critical gaps include:

  1. Mechanistic Insights: Determining FAM73B’s role in mitochondrial biogenesis, apoptosis, or stress responses.

  2. Cross-Species Validity: Comparing zebrafish FAM73B to human MIGA2 in functional assays.

  3. Disease Models: Exploring its relevance to mitochondrial disorders or neurodegenerative diseases.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
miga2; fam73b; zgc:113131; Mitoguardin 2; Protein FAM73B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-596
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
miga2
Target Protein Sequence
MSFRSAEGVSIMQALAMTVAEIPVFLYSTFGQSIFSQLKLSPSLKKVLFATALGSVALAL TAHQLKRRGRKRKQTLGKEAQKPVGIPEQLLRSSRPASLKRGPVPARQMMSPSTRSNDTL SGVSSIAQSKHSSSSHSIASMRVPSSPNQSVNAGAAWEAEPVAEEPAVGEDANAENLYLM GMELFEEALRKWELALNIRHRSHSRASASNSQGSELVERHSPEVRNHQFAERLETLLHRA YHLQEDFGSTIPPDSLLADLESEGTLILPTLGSSHPIQDDDATTVTSDDSFFSAAELFET FSLEDSFHLLKPAALYEEALSLVKDGDVACRSLRTELLECYSDQDFLAKLHCVRQAFQVL LLDETHRMFFMETGKQMISGLLVKANKSPKAFLESYEDMLQYTQREETWPVSKMELEGRG VVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRR LLMVPDGFIAHFYVISEHVSPVLAFGFLGPHQHLSEVCTIFKQQIVQYLKDMFDHDKVRF TSVPSLAEDILRLSHRRADILMGYLGIENLPETNGALPKSPCQAESGNLDASGQQD
Uniprot No.

Target Background

Function
A regulator of mitochondrial fusion, FAM73B forms homo- and heterodimers at the mitochondrial outer membrane, facilitating pld6/MitoPLD dimer formation. It may regulate phospholipid metabolism via pld6/MitoPLD.
Database Links

KEGG: dre:541431

UniGene: Dr.38403

Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is FAM73B protein in Danio rerio and how does it differ from mammalian orthologs?

FAM73B (Family with sequence similarity 73 member B) is a mitochondrial outer membrane protein in zebrafish that regulates mitochondrial morphology. While the core function of controlling mitochondrial dynamics appears conserved across vertebrates, zebrafish FAM73B (also referred to as MIGA2) functions primarily in regulating the switch from mitochondrial fusion to fission. In zebrafish as in mammals, FAM73B ablation promotes mitochondrial fission and subsequently alters immune cell function, particularly in macrophages and dendritic cells .

The protein exhibits functional conservation with mammalian orthologs, as demonstrated by similar phenotypic outcomes when the gene is deleted in mouse models. Both systems show enhanced IL-12 production and anti-tumor immune responses when FAM73B is absent .

What are the key structural domains of zebrafish FAM73B relevant to its function?

Based on the available research, FAM73B contains functional domains that anchor it to the mitochondrial outer membrane, allowing it to mediate mitochondrial dynamics. While the search results don't detail specific domains, the protein's localization to the mitochondrial membrane is essential for its role in regulating morphological transitions between fusion and fission states .

The functional importance of this localization is demonstrated by experiments showing that deletion of FAM73B leads to severe mitochondrial fragmentation, indicating its role in maintaining normal mitochondrial network structure .

How is FAM73B expression regulated during zebrafish development?

While the current search results don't specifically address FAM73B developmental expression patterns in zebrafish, research on related FAM family proteins in zebrafish provides some insights. For example, FAM83F shows developmental stage-specific expression, particularly in hatching gland tissues of developing embryos .

By analogy, FAM73B likely exhibits tissue-specific and developmental stage-specific expression patterns that correspond to its functions in mitochondrial dynamics and immune system development. Research examining expression patterns using techniques similar to those applied for FAM83F (including in situ hybridization and developmental transcriptomics) would be valuable for understanding FAM73B's developmental regulation .

What are the most effective approaches for generating FAM73B knockout zebrafish models?

CRISPR/Cas9 genome editing represents the most effective approach for generating FAM73B knockout zebrafish. Based on methodologies described for related studies, researchers should:

  • Design sgRNAs using tools like CHOPCHOP with the GRCz10 assembly and default search parameters

  • Select sgRNAs based on their predicted efficiency and lack of off-target effects

  • Assemble sgRNAs with Cas9 protein into ribonucleoprotein complexes

  • Microinject these complexes into one-cell stage zebrafish embryos

  • Screen F0 fish for mutations and establish stable knockout lines through selective breeding

For confirmation of knockout, genotyping using PCR and sequencing of the target region is essential, followed by functional validation through assessment of mitochondrial morphology and immune phenotypes .

What are the recommended protocols for studying FAM73B-mediated mitochondrial dynamics in zebrafish cells?

To effectively study FAM73B-mediated mitochondrial dynamics in zebrafish cells, researchers should utilize the following methodological approaches:

  • Live imaging of mitochondrial morphology using fluorescent mitochondrial markers (such as MitoTracker dyes) in wild-type versus FAM73B knockout cells

  • Confocal microscopy with Z-stack imaging using a setup similar to that described in the literature: "a Zeiss inverted Axio Observer LSM 710 confocal microscope, using the 405, 543 and 639 nm laser lines to capture Z stack images"

  • Quantitative assessment of mitochondrial network parameters (length, interconnectivity, fragmentation)

  • Analysis of mitochondrial function using respirometry and membrane potential measurements

  • Comparison of mitochondrial dynamics before and after cellular stressors or immune stimulation

These approaches allow for detailed characterization of how FAM73B influences mitochondrial network structure and function under various physiological conditions.

How can recombinant Danio rerio FAM73B protein be effectively expressed and purified for in vitro studies?

For expressing and purifying functional recombinant zebrafish FAM73B:

  • Clone the FAM73B coding sequence into a bacterial expression vector with appropriate affinity tags

  • Express in E. coli using a system optimized for membrane proteins, such as BL21(DE3) with specialized helper plasmids

  • Consider using detergent solubilization methods appropriate for mitochondrial membrane proteins

  • Purify using affinity chromatography followed by size exclusion chromatography

  • Verify protein quality through SDS-PAGE, Western blotting, and functional assays

As FAM73B is a mitochondrial membrane protein, special attention must be paid to maintaining its native conformation during purification. Approaches used for other membrane proteins, such as inclusion of appropriate lipids or detergents during purification, may enhance stability and functionality .

How does FAM73B regulate macrophage polarization and cytokine production?

FAM73B controls macrophage polarization through its effects on mitochondrial dynamics, which subsequently regulate immune signaling pathways. Specifically:

  • FAM73B regulates the switch from mitochondrial fusion to fission in response to Toll-like receptor (TLR) activation

  • Ablation of FAM73B (Miga2) promotes mitochondrial fission, which enhances production of IL-12 while inhibiting IL-10 and IL-23 expression

  • This cytokine profile shift promotes Th1-type immune responses

  • The mechanism involves altered Parkin recruitment to mitochondria, which affects the CHIP-IRF1 signaling axis

The research demonstrates that "myeloid cell but not T cell conditional knockout mice have enhanced Th1 responses," indicating the specificity of this regulatory pathway to myeloid lineage cells such as macrophages and dendritic cells .

What experimental approaches can measure the impact of FAM73B on anti-tumor immunity?

To assess FAM73B's influence on anti-tumor immunity, researchers can employ these methodological approaches:

  • Tumor challenge models: Inoculate FAM73B knockout and wild-type zebrafish or mice with compatible tumor cells (e.g., melanoma cells in mice) and monitor:

    • Tumor growth rates

    • Survival curves

    • Tumor-infiltrating immune cell profiles

  • Immune response analysis:

    • Measure serum cytokine levels (IL-12, IL-10, IFN-γ) by ELISA

    • Analyze T-cell activation status by flow cytometry (CD4+ and CD8+ IFN-γ+ cells)

    • Characterize tumor-associated macrophage polarization

  • Mechanistic validation:

    • Perform adoptive transfer experiments to confirm the role of specific immune cell populations

    • Use neutralizing antibodies against key cytokines to validate their role in the observed phenotypes

Studies have shown that "FAM73B deletion profoundly suppressed tumor growth and increased the survival rate of tumor-bearing mice," making this a promising area for therapeutic development .

What is the molecular mechanism by which FAM73B regulates mitochondrial fusion/fission balance?

FAM73B regulates mitochondrial morphology through a complex molecular mechanism:

  • Under normal conditions, FAM73B promotes or maintains mitochondrial fusion

  • Upon TLR activation, a switch from fusion to fission occurs

  • FAM73B depletion causes "severe mitochondrial fragmentation," indicating its role in preventing excessive fission

  • Unlike other mitochondrial fusion regulators (Mfn1/Mfn2), FAM73B appears to function through a distinct mechanism, as "Mfns are dispensable for the mitochondrial morphology switch under polarization stress"

These findings suggest FAM73B operates through a novel pathway to maintain mitochondrial network integrity, potentially by regulating the activity or localization of fission/fusion machinery components .

How does the FAM73B-Parkin-IRF1 signaling axis function in immune cells?

The FAM73B-Parkin-IRF1 signaling axis operates through the following mechanism:

  • Mitochondrial fission (promoted by FAM73B ablation) enhances Parkin expression and recruitment to mitochondria

  • Recruited Parkin induces degradation of monoubiquitinated CHIP (C-terminus of HSC70-interacting protein)

  • CHIP degradation stabilizes IRF1 (Interferon Regulatory Factor 1), a key transcription factor

  • Stabilized IRF1 promotes transcription of IL-12 and other pro-inflammatory genes

  • This signaling cascade ultimately enhances Th1-type immune responses and anti-tumor immunity

This pathway represents a previously unappreciated link between mitochondrial dynamics and immune signaling, highlighting how changes in organelle morphology can directly impact transcriptional programs in immune cells .

How can protein-protein interactions of FAM73B be effectively mapped to identify novel regulatory partners?

To comprehensively map FAM73B protein interactions:

  • BioID or proximity labeling approaches:

    • Express FAM73B fused to a promiscuous biotin ligase (BirA*) in zebrafish cells

    • Identify proteins in proximity to FAM73B through streptavidin pulldown and mass spectrometry

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Generate antibodies against zebrafish FAM73B or use epitope-tagged versions

    • Perform immunoprecipitation under conditions that preserve native interactions

    • Identify binding partners through proteomics

  • In vitro binding assays:

    • Express recombinant domains of FAM73B

    • Use methods similar to those described in the literature: "in vitro binding assays using recombinant proteins and synthetic biotinylated peptides"

    • Validate interactions through methods like surface plasmon resonance

  • Yeast two-hybrid or mammalian two-hybrid screening:

    • Use FAM73B as bait to screen for interactors from zebrafish cDNA libraries

These approaches would help identify novel FAM73B interactors beyond the known relationships with mitochondrial dynamics and Parkin signaling pathways.

What are the differential effects of FAM73B mutation versus complete knockout in zebrafish models?

While the search results don't specifically address this comparison, addressing differential effects would involve:

  • Generating both null mutations (complete knockout) and specific domain mutations in FAM73B

  • Comparing phenotypes:

    • Complete knockout likely produces maximal mitochondrial fragmentation and enhanced IL-12 production

    • Domain-specific mutations may reveal more nuanced functions, potentially separating mitochondrial and immune regulatory roles

  • Dose-dependent effects:

    • Heterozygous versus homozygous knockout comparisons

    • Conditional or inducible knockout systems to study temporal requirements

  • Rescue experiments:

    • Reintroduction of wild-type versus mutant FAM73B to determine which domains are essential for restoring normal function

This approach would provide insights into structure-function relationships and potentially identify domains that could be selectively targeted for therapeutic purposes.

How can high-throughput screening approaches identify small molecule modulators of FAM73B function?

For identifying small molecule modulators of FAM73B:

  • Primary screening assays:

    • Develop zebrafish reporter lines that visualize mitochondrial morphology (e.g., fluorescent mitochondrial markers)

    • Screen compound libraries for molecules that phenocopy FAM73B knockout or rescue FAM73B deficiency

    • Utilize the advantages of zebrafish for "high-throughput drug screening" due to their small size and transparency

  • Secondary validation:

    • Confirm direct binding to FAM73B using thermal shift assays or surface plasmon resonance

    • Validate effects on mitochondrial dynamics in isolated cells

    • Test effects on IL-12 production and immune cell function

  • Mechanistic studies:

    • Determine if identified compounds affect FAM73B expression, localization, or protein-protein interactions

    • Assess effects on the Parkin-CHIP-IRF1 axis

  • In vivo validation:

    • Test promising compounds in tumor models to assess effects on anti-tumor immunity

This approach could identify therapeutic candidates that modulate mitochondrial dynamics and immune responses for applications in cancer immunotherapy.

How conserved is FAM73B function across vertebrate species from zebrafish to humans?

The conservation of FAM73B function across vertebrates appears substantial based on current research:

  • Functional conservation:

    • Both zebrafish and mammalian FAM73B regulate mitochondrial dynamics

    • The role in immune regulation appears conserved, with similar effects on IL-12 production and anti-tumor responses

    • The connection to Parkin signaling is observed across species

  • Structural conservation:

    • The mitochondrial outer membrane localization is maintained across species

    • The ability to influence mitochondrial morphology is preserved from fish to mammals

  • Regulatory conservation:

    • TLR-mediated regulation of mitochondrial dynamics appears to be a conserved mechanism across vertebrates

This high degree of conservation suggests that insights gained from zebrafish models of FAM73B function can provide valuable information relevant to human biology and disease.

What advantages does the zebrafish model offer for studying FAM73B compared to mammalian systems?

Zebrafish offer several distinct advantages for studying FAM73B function:

  • Developmental accessibility:

    • External fertilization and development allow for direct observation of mitochondrial dynamics during embryogenesis

    • Transparency of embryos facilitates real-time imaging of mitochondrial morphology in intact organisms

  • Genetic tractability:

    • Efficient genome editing using CRISPR/Cas9 as demonstrated in the literature

    • Ability to generate transgenic reporter lines for visualizing mitochondrial dynamics

  • High-throughput capabilities:

    • Zebrafish larvae are amenable to automated imaging and phenotypic analysis

    • Drug screening can be performed in a whole-organism context

  • Comparative insights:

    • The evolutionary distance between zebrafish and mammals can highlight essential conserved functions of FAM73B

    • Zebrafish-specific adaptations may reveal novel aspects of mitochondrial regulation

These advantages make zebrafish an excellent complementary model to mammalian systems for comprehensive understanding of FAM73B biology.

What is the potential of targeting FAM73B for cancer immunotherapy approaches?

The research suggests significant potential for targeting FAM73B in cancer immunotherapy:

  • Mechanism-based rationale:

    • FAM73B deletion "profoundly suppressed tumor growth and increased the survival rate of tumor-bearing mice"

    • The mechanism involves enhanced IL-12 production by macrophages and increased T-cell activation

    • This creates a more effective anti-tumor immune environment

  • Potential therapeutic strategies:

    • Small molecule inhibitors of FAM73B function

    • Genetic approaches to modulate FAM73B expression in tumor-associated macrophages

    • Combination approaches with existing immunotherapies

  • Target validation:

    • The findings that "mitochondrial fission via ablation of Fam73b promotes IL-12 production" and "in tumor-associated macrophages, this switch results in T-cell activation and enhances anti-tumor immunity" provide strong pre-clinical validation

The authors specifically conclude that "mechanisms associated with mitochondrial dynamics control anti-tumor immune responses and that are potential targets for cancer immunotherapy," highlighting the translational potential of this research .

How might FAM73B dysfunction contribute to mitochondrial disease pathogenesis?

While not directly addressed in the search results, the role of FAM73B in mitochondrial dynamics suggests potential contributions to mitochondrial disease:

  • Potential pathogenic mechanisms:

    • Disruption of mitochondrial network homeostasis

    • Altered mitochondrial quality control through disrupted Parkin recruitment

    • Imbalanced mitochondrial fusion/fission leading to bioenergetic defects

  • Immune dysregulation:

    • Altered cytokine production could contribute to inflammatory manifestations of mitochondrial diseases

    • Dysregulated macrophage function might impact tissue homeostasis

  • Cellular stress responses:

    • FAM73B's involvement in the cellular response to stress suggests its dysfunction could exacerbate cellular damage in mitochondrial disease contexts

Further research specifically examining FAM73B in mitochondrial disease models would help clarify these potential connections and identify therapeutic opportunities.

What are the key challenges in generating antibodies against zebrafish FAM73B and how can they be overcome?

Generating effective antibodies against zebrafish FAM73B presents several challenges:

  • Primary challenges:

    • Limited commercial availability of zebrafish-specific antibodies

    • Potential low endogenous expression levels, as suggested by research on related proteins: "Fam83fa protein is itself targeted to the lysosome, making it difficult to detect at the endogenous level"

    • Cross-reactivity concerns with other mitochondrial membrane proteins

  • Recommended solutions:

    • Generate peptide antibodies against unique regions of zebrafish FAM73B

    • Produce recombinant fragments for immunization, focusing on non-membrane domains

    • Validate specificity using FAM73B knockout tissues as negative controls

    • Consider epitope tagging approaches (HA, FLAG, etc.) as alternatives to detecting endogenous protein

  • Validation strategies:

    • Western blotting with appropriate controls

    • Immunofluorescence with subcellular markers to confirm mitochondrial localization

    • Immunoprecipitation to verify interaction with known partners like Parkin

These approaches would help overcome the technical barriers to studying endogenous FAM73B in zebrafish systems.

What are the best approaches for measuring mitochondrial dynamics in live zebrafish in response to FAM73B manipulation?

To effectively measure mitochondrial dynamics in live zebrafish:

  • Transgenic reporter lines:

    • Generate lines expressing mitochondrially-targeted fluorescent proteins (e.g., mito-GFP, mito-DsRed)

    • Create FAM73B knockout or conditional lines with these reporters

    • Develop dual-color systems to visualize both fusion and fission events

  • Live imaging techniques:

    • Confocal microscopy of specific tissues in embryos/larvae

    • Light-sheet microscopy for whole-organism imaging

    • Time-lapse imaging to capture dynamic changes in mitochondrial morphology

  • Quantitative analysis:

    • Develop automated image analysis pipelines to quantify parameters such as:

      • Mitochondrial length, area, and circularity

      • Network connectivity and branching

      • Fusion and fission rates

  • Perturbation approaches:

    • Chemical treatments that induce mitochondrial stress

    • Genetic manipulations of FAM73B expression

    • Environmental stressors to trigger dynamic responses

These approaches would provide comprehensive insights into how FAM73B regulates mitochondrial dynamics in vivo in the context of a whole organism.

What are the unexplored aspects of FAM73B function in zebrafish development and physiology?

Several important aspects of FAM73B biology remain to be explored:

Investigation of these aspects would provide a more comprehensive understanding of FAM73B biology beyond its established roles in mitochondrial dynamics and immune function.

How might the interplay between FAM73B and other mitochondrial dynamics regulators be systematically investigated?

To systematically investigate FAM73B interactions with other mitochondrial dynamics regulators:

  • Genetic interaction studies:

    • Generate compound mutants of FAM73B with other fusion/fission regulators (e.g., Drp1, Mfn1/2, Opa1)

    • Perform genetic epistasis analysis to determine pathway relationships

    • Use CRISPR screening approaches to identify synthetic lethal or suppressor interactions

  • Proteomic approaches:

    • Conduct comparative proteomics of mitochondria from wild-type versus FAM73B knockout zebrafish

    • Perform temporal analysis of protein interactions during fusion/fission transitions

    • Apply proximity labeling to identify context-specific interaction partners

  • High-resolution imaging:

    • Use super-resolution microscopy to visualize co-localization with other dynamics regulators

    • Implement live-cell imaging to track temporal relationships during morphology changes

  • Systems biology approaches:

    • Integrate transcriptomic, proteomic, and functional data to build comprehensive network models

    • Apply mathematical modeling to predict emergent properties of the mitochondrial dynamics system

These approaches would clarify how FAM73B functions within the broader context of mitochondrial dynamics regulation and identify key nodes for potential therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.