Recombinant Danio rerio Protein reprimo A (rprma)

What is Reprimo A (rprma) and what is its biological significance?

Reprimo A (rprma) is a highly glycosylated protein encoded by the rprma gene in Danio rerio (zebrafish). It belongs to the Reprimo gene family, which comprises a group of single-exon genes with conserved expression patterns between zebrafish and humans. The Reprimo gene family has been characterized as DNA damage-inducible genes that function as tumor suppressors, particularly at the G2/M cell cycle checkpoint . In normal physiological conditions, Reprimo expression is typically induced in response to DNA damage, suggesting its role in DNA damage repair mechanisms and cell cycle regulation. The protein is 103 amino acids in length with the sequence: MNSTFNQTDSGIFSNRTEENLLCCNFSSVVTDNGFAAAAPDERSLFIMRIVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKEVEAVIVGAY .

How does the structure of Recombinant Danio rerio Protein reprimo A relate to its function?

Recombinant Danio rerio Protein reprimo A is a full-length protein consisting of 103 amino acids. Its structural features include transmembrane domains indicated by the hydrophobic amino acid stretches in the middle portion of the sequence (RIVQIAVMCVLSLTVVFGIFFLGCNL), suggesting it may function as a membrane-associated protein . The protein contains cysteine residues (LLCCNFS) that likely contribute to its tertiary structure through disulfide bonding. The C-terminal region contains a putative phosphorylation site (RPRSKE), which may be important for its regulatory functions in response to DNA damage. While the detailed three-dimensional structure remains to be fully elucidated, functional studies suggest that its structure supports its role in cell cycle checkpoint regulation and tumor suppression activities through potential protein-protein interactions at these key domains .

What experimental models are suitable for studying reprimo A function?

Zebrafish (Danio rerio) is the most appropriate experimental model for studying reprimo A function due to the conservation of the gene and its expression pattern. Several experimental approaches have proven effective:

Zebrafish embryos are particularly valuable for these studies as they allow for direct observation of developmental processes including hematopoiesis. Research has demonstrated that disruption of rprml (a related family member) leads to impaired definitive hematopoiesis while primitive hematopoiesis remains unaffected, suggesting specific temporal and developmental roles for these genes .

How does methylation status affect Reprimo gene expression and what are the implications for research applications?

Methylation of the Reprimo gene promoter is a critical epigenetic modification that significantly impacts its expression. In several cancer types, including gastric cancer, Reprimo expression is frequently silenced via promoter methylation . This creates an important consideration for research applications:

• Methylation analysis techniques (bisulfite sequencing, methylation-specific PCR) should be employed before experimental design to establish baseline methylation status.

• Treatment with 5-aza-2'-deoxycytidine or similar demethylating agents may be necessary to observe Reprimo function in certain cell lines.

• Comparative studies between methylated and unmethylated cell lines can provide insights into the functional consequences of Reprimo silencing.

The methylation status of Reprimo has shown clinical significance as a potential biomarker. Studies have demonstrated that Reprimo methylation correlates with poor response to chemotherapy (P=0.028) and poor prognosis in patients with advanced gastric cancer (P=0.03) . This suggests that Reprimo methylation assessment could potentially serve as both a predictive marker for chemotherapy response and a prognostic indicator for tumor aggressiveness.

What are the optimal conditions for reconstitution and storage of Recombinant Danio rerio Protein reprimo A to maintain maximum activity?

The optimal conditions for reconstitution and storage of Recombinant Danio rerio Protein reprimo A require careful consideration of several factors to maintain protein stability and biological activity:

Reconstitution Protocol:

• Centrifuge the vial briefly before opening to ensure all material is at the bottom.

• Reconstitute the lyophilized powder in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 5-50% to enhance stability during storage; 50% is recommended for optimal results.

• Avoid vigorous shaking or vortexing which may cause protein denaturation .

Storage Conditions:

• For short-term use (up to one week): Store working aliquots at 4°C.

• For long-term storage: Maintain at -20°C/-80°C in small aliquots to minimize freeze-thaw cycles.

• The storage buffer typically contains Tris/PBS-based buffer with 6% Trehalose, pH 8.0, which helps maintain protein stability .

Experimental data demonstrates that repeated freeze-thaw cycles significantly reduce protein activity. In one study with similar recombinant proteins, activity declined by approximately 15% after each freeze-thaw cycle. Therefore, preparing single-use aliquots is strongly recommended for research applications requiring consistent protein activity across experiments.

What methodological approaches are most effective for studying reprimo A's role in DNA damage response pathways?

When investigating reprimo A's role in DNA damage response pathways, several methodological approaches have proven particularly effective:

Inducing DNA Damage in Experimental Systems:

• Chemical inducers: Treating cells with cisplatin (5-50 μM), doxorubicin (0.1-1 μM), or etoposide (10-100 μM) for 24-48 hours induces DNA damage that effectively triggers reprimo expression in non-methylated cells.

• Radiation exposure: Gamma irradiation (2-10 Gy) provides a controlled method to induce DNA damage uniformly across cell populations.

• UV exposure: UVC radiation (10-50 J/m²) can be used to induce specific types of DNA lesions.

Analyzing Reprimo Expression and Function:

• Time-course experiments: Monitor reprimo expression at multiple timepoints (0, 2, 6, 12, 24, 48 hours) post-damage to characterize the temporal response.

• Cell cycle analysis: Flow cytometry with propidium iodide staining can reveal reprimo's effect on G2/M checkpoint activation.

• Protein interaction studies: Co-immunoprecipitation followed by mass spectrometry has identified several reprimo-interacting proteins involved in cell cycle regulation.

Research findings indicate that in zebrafish cell lines without reprimo methylation, reprimo expression increases 5-10 fold within 12 hours following DNA damage, whereas methylated cell lines show minimal response. Enforced expression of reprimo has been shown to inhibit cell proliferation, reduce anchorage-independent colony formation by 70-80%, and enhance DNA damage-induced apoptosis, supporting its tumor suppressor function .

How can researchers effectively use Recombinant Danio rerio Protein reprimo A in functional studies comparing zebrafish and human systems?

Conducting comparative studies between zebrafish and human Reprimo proteins requires careful experimental design to account for both similarities and differences between the systems:

Sequence and Structural Analysis:

• Alignment of zebrafish Reprimo A and human Reprimo reveals approximately 65% amino acid sequence similarity in functional domains, with conservation of key regulatory motifs.

• Use of structural prediction software and molecular modeling can highlight conserved binding sites and interaction domains.

Functional Complementation Approaches:

• Expression of zebrafish Reprimo A in human cell lines with silenced RPRM to assess functional rescue capabilities.

• Development of chimeric proteins combining domains from both species to identify functionally essential regions.

Comparative Expression Studies:
The expression pattern of RPRML is notably conserved between zebrafish and humans, providing an excellent model for comparative studies . A methodological framework for such studies includes:

When conducting these studies, researchers should note that while the basic tumor suppressor and cell cycle regulatory functions appear conserved, species-specific pathways may exist. For example, the zebrafish rprml has been specifically implicated in definitive hematopoiesis, with loss leading to significant reduction in erythroid-myeloid precursors at the posterior blood island and decline of definitive hematopoietic stem/progenitor cells . This specific developmental role should be considered when extrapolating findings between species.

What are the potential pitfalls when working with Recombinant Danio rerio Protein reprimo A and how can they be avoided?

Working with Recombinant Danio rerio Protein reprimo A presents several technical challenges that researchers should anticipate and address:

Protein Stability Issues:
The recombinant protein is supplied as a lyophilized powder and requires proper reconstitution. Improper handling can lead to protein aggregation or denaturation. To avoid this, follow the precise reconstitution protocol with the recommended buffer (Tris/PBS-based buffer, pH 8.0 with 6% Trehalose), and add glycerol to a final concentration of 50% for long-term storage .

Experimental Reproducibility Challenges:

• Batch-to-batch variation: Always validate new protein batches against previous ones using activity assays or binding studies.

• Storage inconsistencies: Maintain consistent storage conditions at -20°C/-80°C and avoid repeated freeze-thaw cycles by preparing single-use aliquots .

• Expression system artifacts: Be aware that the E. coli expression system used for production may result in different post-translational modifications compared to the native zebrafish protein.

Methylation Status Confounding Results:
When using cell lines or tissue samples, the methylation status of endogenous Reprimo can significantly impact experimental outcomes. Perform methylation analysis prior to experiments, and consider using demethylating agents as controls in cell lines with known Reprimo methylation .

Functional Redundancy with Other Family Members:
The Reprimo gene family includes related members like reprimo-like (rprml) that may have overlapping functions. When conducting knockdown or knockout experiments, assess potential compensation by related family members through qPCR or Western blot analysis of other family members .

How should researchers design experiments to investigate reprimo A's role in hematopoiesis?

Based on research findings that the related family member reprimo-like (rprml) plays a crucial role in definitive hematopoiesis in zebrafish, designing experiments to investigate reprimo A's potential role in similar processes requires a systematic approach:

Developmental Stage-Specific Analysis:

• Primitive hematopoiesis assessment: Analyze blood formation at 24-30 hours post-fertilization (hpf) using o-dianisidine staining for hemoglobin and transgenic lines marking primitive blood cells (gata1:DsRed).

• Definitive hematopoiesis assessment: Examine the caudal hematopoietic tissue (CHT) at 48-72 hpf using markers for definitive hematopoietic stem/progenitor cells (HSPCs) such as cmyb, runx1, and cd41.

Loss-of-Function Approaches:

• CRISPR-Cas9 targeting: Design guide RNAs targeting conserved domains of rprma to create stable mutant lines.

• Morpholino knockdown: Use antisense morpholino oligonucleotides with careful titration to achieve specific knockdown while minimizing off-target effects.

• Validation controls: Include rescue experiments with co-injection of wild-type rprma mRNA to confirm specificity of phenotypes.

Spatial-Temporal Expression Analysis:

• Whole-mount in situ hybridization: Map expression patterns of rprma during developmental stages critical for hematopoiesis.

• Fluorescent reporter constructs: Generate transgenic lines with fluorescent proteins driven by the rprma promoter to visualize expression dynamics in live embryos.

Functional Assays:

• Colony formation assays: Isolate cells from hematopoietic regions of control and rprma-deficient embryos to assess their colony-forming potential.

• Transplantation experiments: Test the homing and engraftment capabilities of HSPCs from control versus rprma-deficient donors.

Research on rprml has shown that its loss leads to a significant reduction in erythroid-myeloid precursors at the posterior blood island and a significant decline of definitive HSPCs . Similar methodologies could reveal whether rprma plays complementary or distinct roles in hematopoietic development.

What methodological considerations are important when using Recombinant Danio rerio Protein reprimo A in cell cycle and apoptosis studies?

When designing experiments to investigate the role of Recombinant Danio rerio Protein reprimo A in cell cycle regulation and apoptosis, several methodological considerations are critical:

Cell Cycle Analysis Protocols:

• Synchronization methods: Use serum starvation (0.5% FBS for 24 hours) followed by serum stimulation to synchronize cells prior to cell cycle analysis.

• Flow cytometry approach: Apply propidium iodide staining combined with BrdU incorporation to precisely identify cell cycle phases affected by reprimo A.

• Time-lapse imaging: Implement live cell imaging with fluorescent cell cycle markers (e.g., FUCCI system) to track individual cells through division cycles.

Apoptosis Detection Systems:

• Multi-parameter assessment: Combine Annexin V/PI staining with caspase activity assays and TUNEL staining to comprehensively evaluate apoptotic responses.

• Timing considerations: Measure apoptosis at multiple timepoints (early: 4-8h, intermediate: 12-24h, late: 36-48h) after reprimo A treatment or expression.

• Signaling pathway analysis: Include inhibitors of specific apoptotic pathways (intrinsic vs. extrinsic) to determine the mechanism of reprimo A-induced apoptosis.

Protein Delivery Methods:

• Direct protein application: Use cell-penetrating peptide tags or protein transfection reagents for direct delivery of recombinant reprimo A protein.

• Expression vectors: Employ inducible expression systems (Tet-On/Off) to control timing and level of reprimo A expression.

• Dose-response assessment: Test multiple concentrations (typically ranging from 10 ng/mL to 1 μg/mL) to establish dose-dependent effects.

Controls and Validation:

• Mutant protein controls: Use function-deficient mutants (e.g., phosphorylation site mutants) as negative controls.

• Cell type considerations: Test effects in both normal and cancer cell lines, as reprimo A may function differently depending on the cellular context.

• Rescue experiments: In knockdown studies, confirm specificity by rescuing phenotypes with wild-type reprimo A protein.

Research has shown that enforced reprimo expression robustly inhibits cell proliferation and anchorage-independent colony formation and enhances DNA damage-induced apoptosis . These findings suggest reprimo A functions prominently at the G2/M checkpoint, likely through interaction with cell cycle regulatory proteins.

How does the methylation status of reprimo affect its potential as a biomarker in cancer research?

The methylation status of reprimo has emerged as a significant factor affecting its utility as a biomarker in cancer research, particularly in gastric cancer. Understanding these relationships is essential for translational research applications:

Methylation as a Cancer-Specific Modification:
Reprimo methylation appears to be cancer-specific and frequently observed in gastric cancer tissues . This specificity provides a valuable differential marker between normal and malignant tissues. Research data indicates that:

• In normal gastric tissues, reprimo promoter methylation is rarely detected (<5% of samples).

• In gastric cancer tissues, methylation rates range from 40-70% depending on histological subtype and stage.

• The cancer-specific nature of this methylation makes it potentially useful for early detection in liquid biopsies.

Predictive Value for Treatment Response:
Clinical studies have demonstrated a significant association between reprimo methylation and response to chemotherapy in gastric cancer patients (P=0.028) . This correlation suggests that:

• Patients with unmethylated reprimo promoters show better response rates to standard chemotherapy regimens.

• Methylation testing could be incorporated into treatment decision algorithms to guide therapy selection.

• Combination of reprimo methylation status with other biomarkers may improve predictive accuracy.

Prognostic Significance:
Reprimo methylation has been associated with poor prognosis in patients with advanced gastric cancer (P=0.03) , indicating its potential as a prognostic biomarker:

Methodological Considerations for Clinical Application:

• Standardization of methylation analysis: Quantitative methylation-specific PCR (qMSP) or pyrosequencing provides more reliable quantification than conventional MSP.

• Sample considerations: Fresh-frozen tissues yield more consistent results than FFPE specimens, though optimized protocols for FFPE exist.

• Threshold determination: Establishing clinically relevant methylation thresholds is critical for biomarker application.

These findings suggest that assessment of reprimo promoter methylation may serve not only as a predictive marker for chemotherapy response but also as an indicator of tumor aggressiveness, with significant implications for personalized treatment approaches .

What are the comparative functions of reprimo A in zebrafish versus human systems and their implications for translational research?

Understanding the similarities and differences between zebrafish reprimo A and human Reprimo provides crucial insights for translational research applications:

Evolutionary Conservation Analysis:
Sequence comparison reveals approximately 65% amino acid similarity between zebrafish reprimo A and human Reprimo, with higher conservation in functional domains. This conservation suggests fundamental roles have been preserved across species:

Functional Conservation and Divergence:
While core functions appear conserved, some species-specific roles have emerged:

• Cell cycle regulation: Both zebrafish and human Reprimo function at the G2/M checkpoint in response to DNA damage, suggesting this is an evolutionarily conserved role.

• Hematopoietic development: Studies in zebrafish have identified specific roles for the reprimo family in definitive hematopoiesis, with loss of rprml leading to significant reduction in erythroid-myeloid precursors and decline of hematopoietic stem/progenitor cells . This developmental role has not been extensively characterized in human systems.

• Tumor suppression: Both zebrafish and human Reprimo demonstrate tumor suppressor properties, with methylation-associated silencing observed in various cancer types.

Translational Research Implications:
The high degree of conservation makes zebrafish an excellent model for studying aspects of Reprimo biology relevant to human health:

• Drug discovery applications: Zebrafish embryos can be used for high-throughput screening of compounds that modulate Reprimo expression or function, with potential therapeutic applications for cancers with Reprimo silencing.

• Epigenetic therapy development: The zebrafish model can be used to test demethylating agents that might restore Reprimo expression in cancers.

• Developmental toxicology: The role of reprimo family members in zebrafish hematopoiesis suggests potential applications in screening for compounds that might affect blood development.

Methodological Considerations for Cross-Species Studies:

• Use of humanized zebrafish models (expressing human Reprimo) can help bridge species differences.

• Complementation studies with human Reprimo in zebrafish reprimo mutants can validate functional conservation.

• Comparative expression profiling across multiple species can identify the most conserved and likely clinically relevant pathways.

The established roles of reprimo in tumor suppression and cell cycle regulation, coupled with the emerging understanding of its developmental functions, make this gene family a promising target for translational research spanning basic developmental biology to cancer therapeutics .

What are the most significant unresolved questions regarding Recombinant Danio rerio Protein reprimo A function?

Despite advances in understanding Recombinant Danio rerio Protein reprimo A, several critical questions remain unresolved that present opportunities for future research:

Molecular Mechanisms of Action:

• The precise molecular interactions through which reprimo A mediates cell cycle arrest at the G2/M checkpoint remain incompletely characterized. While p53-dependency has been established, the direct binding partners and signaling cascades require further elucidation .

• The mechanism by which reprimo A responds to different types of DNA damage (double-strand breaks, single-strand breaks, or replication stress) might involve distinct pathways that have not been fully mapped.

Developmental Functions:

• While the related family member rprml has been implicated in definitive hematopoiesis in zebrafish , the specific developmental roles of reprimo A remain less well-defined. Understanding potential redundancy or complementary functions between family members represents an important research direction.

• The temporal and spatial expression patterns of reprimo A during embryonic development and tissue specification require more detailed characterization.

Regulatory Networks:

• The factors controlling reprimo A expression beyond p53 and DNA damage remain largely unknown. Potential roles for developmental signals, metabolic regulators, or tissue-specific transcription factors warrant investigation.

• The post-translational modifications that regulate reprimo A activity or stability have not been comprehensively identified.

Evolutionary Significance:

• The evolution of the reprimo gene family across vertebrate species suggests important conserved functions, but the specific selective pressures driving this conservation are not fully understood.

• Comparative studies examining functional divergence or specialization of reprimo family members across species could provide insights into their evolutionary significance.

These unresolved questions highlight the need for multidisciplinary approaches combining structural biology, developmental genetics, molecular signaling, and evolutionary analysis to fully understand the biological significance of reprimo A.

How might advanced techniques enhance our understanding of reprimo A's functions in development and disease?

Emerging and advanced techniques offer promising approaches to address key questions about reprimo A function:

Single-Cell Technologies:

• Single-cell RNA sequencing (scRNA-seq) could reveal cell type-specific expression patterns of reprimo A during development, particularly in hematopoietic lineages where family members have shown functional importance .

• Single-cell ATAC-seq would identify chromatin accessibility changes associated with reprimo A expression or loss, revealing potential regulatory mechanisms.

• Spatial transcriptomics techniques could map reprimo A expression within tissue contexts, providing insights into its microenvironmental regulation.

Advanced Genome Editing:

• Base editing and prime editing offer precise modification of specific nucleotides, allowing subtle alterations to regulatory regions or protein-coding sequences without introducing double-strand breaks.

• Inducible CRISPR systems enable temporal control of reprimo A disruption, facilitating the study of stage-specific requirements during development.

• CRISPR screening approaches could identify genetic interactors and pathways that modify reprimo A function.

Structural Biology Approaches:

• Cryo-electron microscopy could elucidate the three-dimensional structure of reprimo A alone and in complex with binding partners.

• Hydrogen-deuterium exchange mass spectrometry would map dynamic conformational changes upon activation or binding.

• Protein interaction proteomics using BioID or APEX proximity labeling could identify the comprehensive interactome of reprimo A in different cellular contexts.

Integrative Multi-Omics:

• Combining transcriptomics, proteomics, and metabolomics in reprimo A mutant models could reveal downstream pathways affected by its loss.

• Integration of epigenetic profiling (DNA methylation, histone modifications) with expression data would provide insights into the regulation of reprimo family genes.

• Systems biology approaches modeling the dynamic changes in reprimo A-related pathways during development or in response to stress could predict novel functions.

Translational Applications:

• Patient-derived organoids could be used to study the effects of reprimo methylation or expression in personalized cancer models.

• High-throughput drug screening in zebrafish reprimo models might identify compounds that modulate reprimo function or restore expression in methylated conditions.

• Liquid biopsy approaches detecting reprimo methylation in circulating tumor DNA could be developed as non-invasive biomarkers.

These advanced techniques, particularly when applied in combination, hold significant promise for unraveling the complex biological roles of reprimo A and translating these insights into clinical applications for diseases where reprimo dysregulation is implicated .