Recombinant Danio rerio Protein reprimo B (rprmb)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio Protein reprimo B (rprmb)

Recombinant Danio rerio Protein reprimo B (rprmb) is a recombinant protein derived from the zebrafish (Danio rerio) ortholog of the RPRM gene family, which includes tumor-suppressor proteins involved in DNA damage response and cell cycle regulation. The zebrafish rprmb gene is a paralog of rprma, arising from teleost-specific genome duplication . This protein is critical for studying developmental neurobiology, cancer biology, and radiation responses in vertebrate models.

Amino Acid Sequence and Gene Information

AttributeDetail
Gene Namerprmb, rprm, zgc:73361
Protein NameProtein reprimo B
UniProt IDQ6PBK8
AA SequenceMNSTGFNDTDSALFSNTSFLSCCNVSSVVTDSGFVSAALDERSVFIMRTVQIAVMCVLAL TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKDVEAVIVGSY
Protein LengthFull-length (1–102 amino acids)
Molecular Weight~11.6 kDa (calculated)

Production and Purity

ParameterDetail
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
TagHis-tag (common), varies by production system
Purity≥85% (SDS-PAGE validated)
Storage BufferTris-based buffer with 50% glycerol
ApplicationsELISA, Western blot, immunoprecipitation, protein array

DNA Damage Response and Cell Cycle Regulation

The rprmb protein is part of the p53-dependent pathway, inducing G2/M cell cycle arrest by inhibiting Cdc2-cyclin B1 complex activity . In zebrafish, it is expressed in response to DNA damage and plays a role in protecting neural cells during radiation exposure .

Neurodevelopmental Expression

Tissue/OrganExpression PatternDevelopmental Stage
Olfactory PlacodesRestricted to anterior forebrain, olfactory epithelium 24–72 hpf
Optic TectumTectum opticum (TeO) and trigeminal ganglion (Tg) 48–72 hpf
HindbrainSensory ganglia and axons 72 hpf

This spatiotemporal expression mirrors conserved RPRM patterns in mammals, suggesting evolutionary conservation in neural development .

Recombinant Protein Uses

ApplicationPurposeSource
ELISAQuantify rprmb levels in zebrafish tissues or lysates
Western BlotDetect rprmb protein expression in developmental stages
Antibody ValidationRabbit polyclonal antibodies (e.g., RPRMB-11062Z) for IHC/WB

Cancer Biology

As a tumor suppressor, RPRM is downregulated in cancers like gastric tumors . Zebrafish models using rprmb recombinant proteins could elucidate mechanisms of RPRM-mediated G2 arrest and tumor suppression.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rprmb; rprm; zgc:73361; Protein reprimo B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
rprmb
Target Protein Sequence
MNSTGFNDTDSALFSNTSFLSCCNVSSVVTDSGFVSAALDERSVFIMRTVQIAVMCVLAL TVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKDVEAVIVGSY
Uniprot No.

Target Background

Function
May be involved in the regulation of p53-dependent G2 cell cycle arrest.
Database Links

KEGG: dre:393779

UniGene: Dr.27132

Protein Families
Reprimo family
Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.

Q&A

What is Reprimo B (rprmb) and how does it differ from other Reprimo family members in zebrafish?

Reprimo B (rprmb) is one of three Reprimo family paralogs found in zebrafish (Danio rerio). The Reprimo family consists of highly conserved single-exon genes, with RPRM being the most characterized member. In the fish lineage, RPRM duplicated to give rise to rprma and rprmb, while a third family member, rprml, is also present .

These three zebrafish paralogs exhibit distinct expression patterns in the developing nervous system. Specifically, rprma mRNA is expressed in the olfactory placodes (OP) and olfactory epithelium (OE), rprmb is observed in the tectum opticum (TeO) and trigeminal ganglion (Tg), and rprml is found primarily in the telencephalon (Tel) . This spatial differentiation suggests these paralogs may have undergone subfunctionalization following gene duplication events, taking on specialized roles in different neuroanatomical structures while potentially maintaining some ancestral functions related to cell cycle regulation.

How is rprmb gene expression regulated during zebrafish development?

The regulation of rprmb expression during zebrafish development follows specific spatiotemporal patterns. Based on developmental studies, rprmb expression is observed primarily in neural tissues, specifically in the tectum opticum (TeO) and trigeminal ganglion (Tg) .

While specific transcriptional regulators of rprmb in zebrafish are not fully characterized in the provided search results, we can infer from knowledge about mammalian RPRM that p53 likely plays a significant role. In mammalian systems, RPRM expression is controlled by p53, which responds to DNA damage or nutrient deprivation signals . Therefore, investigating whether zebrafish p53 orthologs similarly regulate rprmb expression represents an important research direction. For methodological approaches, researchers should consider using morpholino knockdown or CRISPR/Cas9-mediated editing of p53 in zebrafish followed by assessment of rprmb expression using in situ hybridization or quantitative PCR.

What are the optimal conditions for storing and handling recombinant rprmb protein for experimental use?

For optimal handling of recombinant Danio rerio Protein reprimo B, researchers should adhere to specific storage conditions to maintain protein stability and activity. The recommended storage procedure involves keeping the protein at -20°C in a storage buffer consisting of Tris-based buffer with 50% glycerol, specifically optimized for this protein .

For extended storage periods, conservation at -20°C or -80°C is advised. It is important to note that repeated freezing and thawing cycles significantly reduce protein stability and should be avoided. When working with the protein, researchers should prepare small working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles .

For experimental applications, the recombinant protein should be handled on ice when thawed and used promptly. Depending on the specific assay requirements, buffer exchanges may be necessary, which should be performed using dialysis or desalting columns with minimal temperature fluctuations to preserve protein integrity.

What experimental approaches can be used to study rprmb function in zebrafish models?

Several experimental approaches can be employed to investigate rprmb function in zebrafish models:

  • Gene Knockout/Knockdown Studies: CRISPR/Cas9 gene editing can generate permanent rprmb knockout lines, while morpholino oligonucleotides can be used for transient knockdown. Both approaches allow researchers to observe phenotypic consequences of rprmb deficiency during development and in response to various stressors such as radiation.

  • Expression Analysis: In situ hybridization techniques can map the spatiotemporal expression patterns of rprmb, as demonstrated in studies showing expression in the tectum opticum and trigeminal ganglion . This can be complemented with quantitative PCR to measure expression levels under various experimental conditions.

  • Protein Localization Studies: Immunohistochemistry using antibodies against rprmb can determine its cellular and subcellular localization. Cross-reactivity between human RPRM antibodies and zebrafish Rprm proteins should be verified through sequence alignment and validation experiments .

  • Radiation Response Assays: Based on the role of RPRM in radiation response, zebrafish can be exposed to controlled radiation doses followed by assessment of DNA damage, cell cycle progression, and apoptosis in wild-type versus rprmb-deficient animals. Techniques such as TUNEL assays and γ-H2AX immunostaining would be appropriate for these studies .

  • Cell Cycle Analysis: Flow cytometry of dissociated zebrafish cells can assess the impact of rprmb manipulation on cell cycle progression, particularly focusing on G2/M transition based on mammalian RPRM functions .

How can researchers validate antibody cross-reactivity between human RPRM antibodies and zebrafish rprmb?

Validating antibody cross-reactivity between human RPRM antibodies and zebrafish rprmb requires a systematic approach:

  • Sequence Alignment Analysis: Researchers should first perform multiple sequence alignment between human RPRM and zebrafish rprmb amino acid sequences using tools like MAFFT to identify conserved epitope regions . This bioinformatic approach provides the foundation for predicting potential cross-reactivity.

  • Western Blot Validation: Western blot analysis using human RPRM antibodies against both recombinant zebrafish rprmb protein and zebrafish tissue lysates can detect bands of expected molecular weight. Inclusion of appropriate positive controls (human RPRM) and negative controls (lysates from rprmb knockout zebrafish) is critical.

  • Immunoprecipitation: Immunoprecipitation followed by mass spectrometry can confirm that the antibody is specifically pulling down rprmb protein from zebrafish samples.

  • Immunohistochemistry with Peptide Competition: Performing immunohistochemistry on zebrafish tissue sections with and without pre-absorption of the antibody with recombinant rprmb can demonstrate specificity of staining patterns. Specificity is indicated when pre-absorption eliminates the staining pattern observed in tissues known to express rprmb, such as the tectum opticum and trigeminal ganglion .

  • Knockout/Knockdown Controls: The most definitive validation involves comparing immunostaining patterns between wild-type and rprmb knockout/knockdown zebrafish samples, where a specific antibody should show reduced or absent signal in the knockout/knockdown condition.

How does rprmb contribute to cell cycle regulation in zebrafish?

While direct evidence for rprmb's role in zebrafish cell cycle regulation is limited in the provided search results, we can infer its function based on knowledge of the mammalian RPRM, keeping in mind potential evolutionary divergence in function.

In mammalian systems, RPRM expression is associated with cell cycle arrest at the G2 phase, functioning downstream of p53 . RPRM achieves this arrest through two primary mechanisms: reducing Cdc2 expression and inhibiting the nuclear translocation of cyclin B1, which is necessary for G2/M transition .

To determine if rprmb functions similarly in zebrafish, researchers should:

  • Perform cell cycle analysis in rprmb-deficient versus control zebrafish embryonic cells using flow cytometry with propidium iodide staining to assess DNA content distribution.

  • Measure Cdc2 expression levels and cyclin B1 localization in rprmb-manipulated cells through western blotting, immunofluorescence, and subcellular fractionation.

  • Examine whether DNA damage-induced G2 arrest is compromised in rprmb-deficient zebrafish cells, which would suggest conservation of function with mammalian RPRM.

Based on evolutionary conservation, rprmb likely collaborates with other p53-induced proteins to produce coordinated cellular responses to stress, but the degree to which these functions are conserved requires empirical validation.

What is the role of rprmb in neurological development of zebrafish?

The expression pattern of rprmb in zebrafish strongly suggests a role in neurological development. Specifically, rprmb mRNA is observed in the tectum opticum (TeO) and trigeminal ganglion (Tg), both crucial structures in the developing nervous system .

The tectum opticum is the zebrafish homolog of the mammalian superior colliculus and serves as the primary visual processing center, while the trigeminal ganglion provides sensory innervation to the face and mouth. The specific expression of rprmb in these structures suggests potential roles in:

  • Neural cell fate determination: rprmb may influence progenitor cell proliferation versus differentiation decisions in these specific brain regions.

  • Circuit formation: The protein might participate in establishing proper neural connectivity within the visual system and sensory pathways.

  • Neuroprotection: Given the role of RPRM in cell cycle arrest and DNA damage response, rprmb may protect developing neurons from genomic instability.

To investigate these potential functions, researchers should consider:

  • Analyzing neural development timing and patterning in rprmb knockout zebrafish

  • Performing axon tracing studies to examine circuit formation

  • Assessing neuronal survival and apoptosis rates in the tectum opticum and trigeminal ganglion in the presence and absence of rprmb

  • Conducting behavioral assays to evaluate visual function and sensory responses in rprmb-deficient zebrafish

How does rprmb interact with DNA damage response pathways in zebrafish?

The interaction between rprmb and DNA damage response pathways in zebrafish can be inferred from studies on mammalian RPRM and recent findings on RPRM knockout models.

In mammalian systems, RPRM is induced by DNA damage and plays an important role in DNA damage repair through its negative regulatory effect on ataxia–telangiectasia-mutated (ATM) protein kinase . Recent studies with RPRM knockout mice demonstrated that RPRM deletion significantly reduced hippocampal DNA damage and apoptosis following whole-brain irradiation .

To investigate rprmb's interaction with DNA damage response pathways in zebrafish, researchers should:

  • Expose zebrafish to DNA-damaging agents: Treat wild-type and rprmb-deficient zebrafish with radiation or chemical DNA-damaging agents, then quantify DNA damage markers such as γ-H2AX.

  • Assess ATM pathway activation: Measure phosphorylation levels of ATM and its downstream targets in the presence and absence of rprmb following DNA damage induction.

  • Analyze repair kinetics: Monitor the time course of DNA damage resolution in rprmb-manipulated versus control zebrafish cells using comet assays or γ-H2AX foci resolution.

  • Evaluate cell survival outcomes: Determine whether rprmb modulation affects apoptosis rates following DNA damage through TUNEL assays and cleaved caspase-3 immunostaining.

Based on mammalian studies, we would hypothesize that rprmb-deficient zebrafish might show altered DNA damage responses, potentially with reduced DNA damage and apoptosis following genotoxic stress, similar to observations in RPRM knockout mice .

What differences exist in expression patterns between rprma, rprmb, and rprml in zebrafish, and what do these suggest about their specialized functions?

The three Reprimo family paralogs in zebrafish display distinct expression patterns during development, suggesting specialized functions:

Expression Pattern Comparison:

ParalogPrimary Expression RegionsPotential Specialized Functions
rprmaOlfactory placodes (OP), Olfactory epithelium (OE)Olfactory system development, sensory neuron specification
rprmbTectum opticum (TeO), Trigeminal ganglion (Tg)Visual processing, sensory innervation of face and mouth
rprmlTelencephalon (Tel)Higher brain function, cognitive processing

These distinct expression domains indicate subfunctionalization following gene duplication events . While all three paralogs are expressed in neural tissues, they show clear anatomical specialization, suggesting they have evolved to regulate cell cycle and differentiation processes in specific neuroanatomical structures.

Functional Implications:
This spatial segregation suggests that:

  • Each paralog may interact with region-specific transcription factors and signaling pathways

  • They may regulate cell cycle dynamics in a manner tailored to the developmental needs of different neural tissues

  • They could have evolved specialized protein interaction networks while maintaining some ancestral functions related to cell cycle regulation and DNA damage response

To investigate these specialized functions, researchers should perform paralog-specific knockout studies followed by detailed phenotypic analysis of the affected neuroanatomical structures. Cross-rescue experiments, where one paralog is expressed in place of another, could reveal the degree of functional equivalence versus specialization.

How can studies of rprmb in zebrafish inform our understanding of RPRM-related pathologies in humans?

Studies of rprmb in zebrafish can provide valuable insights into RPRM-related human pathologies through several research applications:

Cancer Research Applications:
Since mammalian RPRM functions as a tumor suppressor gene, zebrafish rprmb studies can inform mechanisms of cancer development. Specifically, aberrant methylation of the RPRM promoter region is observed in various human cancers, leading to its repression . Zebrafish models with mutations or epigenetic modifications of rprmb can serve as platforms to:

  • Identify conserved signaling pathways affected by RPRM deficiency

  • Discover compensatory mechanisms that become active when RPRM function is lost

  • Screen for compounds that restore expression or function of silenced RPRM genes

Neurological Disease Models:
Given the expression of rprmb in specific neural structures, zebrafish rprmb models could be valuable for studying neurological conditions. Researchers can:

  • Investigate whether rprmb-deficient zebrafish exhibit abnormalities in visual processing (tectum opticum) or sensory function (trigeminal ganglion)

  • Determine if human neurological conditions have associated RPRM mutations or expression changes

  • Use high-throughput behavioral assays in zebrafish to screen for compounds that correct rprmb-deficiency phenotypes

Radiation Response Studies:
Recent findings showing that RPRM knockout mitigates radiation-induced brain injury in mice suggest that rprmb studies in zebrafish could inform radiation protection strategies for cancer patients undergoing cranial radiotherapy. Zebrafish rprmb models could be used to:

  • Validate whether rprmb modulation similarly protects against radiation effects in zebrafish

  • Screen for compounds that mimic the protective effects of RPRM deletion

  • Investigate the molecular mechanisms underlying this protective effect

What is the potential significance of rprmb in radiation response and protection based on recent RPRM knockout studies?

Recent studies with RPRM knockout mice have revealed a surprising and potentially significant role for RPRM in radiation response and protection. Contrary to expectations for a tumor suppressor gene, RPRM deletion actually alleviated radiation-induced brain injury (RIBI) in mice exposed to whole-brain irradiation .

The protective mechanisms observed in RPRM knockout mice included:

  • Reduced DNA damage: RPRM knockout significantly reduced hippocampal DNA damage (measured by γ-H2AX levels) shortly after radiation exposure .

  • Decreased apoptosis: Lower levels of radiation-induced apoptosis were observed in RPRM knockout mice .

  • Preserved neurocognitive function: RPRM knockout mice showed amelioration of radiation-induced decline in neurocognitive function .

  • Protected neurogenesis: RPRM knockout dramatically diminished radiation-induced inhibition of neurogenesis .

  • Reduced inflammation: RPRM knockout mice exhibited significantly lower levels of acute and chronic inflammation response and microglial activation following radiation exposure .

These findings suggest that rprmb in zebrafish might play similar roles in radiation response. To investigate this:

  • Researchers should develop rprmb-deficient zebrafish and expose them to radiation protocols that model therapeutic radiation exposure.

  • Key endpoints to measure would include DNA damage markers, apoptosis levels, neurogenesis, and inflammation in brain tissues.

  • If similar protective effects are observed, zebrafish could serve as an efficient model for high-throughput screening of compounds that inhibit rprmb function as potential radioprotectants.

The translational significance of these findings is substantial, as they suggest that targeting RPRM might be a novel approach for protecting against radiation-induced brain injury in patients undergoing cranial radiotherapy for brain tumors .

What advanced experimental approaches could be used to resolve contradictions in rprmb function across different experimental contexts?

Contradictions in rprmb function may emerge across different experimental contexts, particularly given its dual nature as both a tumor suppressor (in cancer contexts) and a potential mediator of radiation damage (in normal tissues). Advanced experimental approaches to resolve such contradictions include:

  • Tissue-specific and inducible genetic manipulation: Utilizing Cre-lox or similar systems adapted for zebrafish to achieve temporal and spatial control of rprmb expression. This allows researchers to distinguish between developmental roles and acute functions in adult tissues.

  • Single-cell transcriptomics: Applying single-cell RNA sequencing to rprmb-manipulated zebrafish tissues can reveal cell type-specific responses that might be masked in bulk tissue analysis. This approach can identify whether rprmb functions differently in distinct cell populations within the same tissue.

  • Protein interaction network mapping: Using BioID or proximity labeling approaches to identify the protein interaction partners of rprmb under different conditions (normal development, DNA damage, etc.). This can reveal context-dependent interaction networks that explain seemingly contradictory functions.

  • Parallel multi-species analysis: Simultaneously investigating rprmb in zebrafish alongside RPRM in mammalian models under identical experimental conditions to distinguish conserved functions from species-specific roles.

  • Domain-specific mutagenesis: Creating zebrafish lines with mutations in specific functional domains of rprmb rather than complete knockout, allowing researchers to dissect which molecular functions contribute to different phenotypic outcomes.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and epigenomic data from rprmb-manipulated zebrafish to develop computational models that predict context-dependent functions.

  • Live imaging of fluorescently tagged rprmb: Monitoring the dynamic localization and expression of rprmb in response to different stimuli in living zebrafish embryos to correlate protein behavior with cellular outcomes.

These methodologies, especially when applied in combination, can help resolve apparent contradictions by revealing how cellular context, developmental stage, and environmental conditions influence rprmb function and downstream effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.