Recombinant Danio rerio Protein tweety homolog 3 (ttyh3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Protein tweety homolog 3 (ttyh3)

Recombinant Danio rerio Protein tweety homolog 3 (ttyh3) is a protein derived from zebrafish (Danio rerio) that belongs to the Tweety family of membrane proteins. This protein family is named after the Drosophila gene and features homologs that are highly conserved across species, from insects to mammals, suggesting important biological functions throughout evolution. In zebrafish, the ttyh3 protein consists of 560 amino acids and has been recombinantly produced with an N-terminal histidine tag in Escherichia coli expression systems for research purposes .

Zebrafish serve as an important model organism in developmental biology and disease research, making the study of zebrafish ttyh3 valuable for understanding the protein's role across vertebrate species. The recombinant production of this protein allows researchers to investigate its structural properties, functional characteristics, and potential applications in biomedical research and therapeutic development.

Membrane Topology and Structure

The transmembrane domains of Tweety proteins, including Danio rerio ttyh3, are relatively conserved among orthologs and paralogs, although significant variation exists at the proteins' C-terminal ends . The structure of TTYH3 has been a subject of debate, particularly regarding the number of transmembrane domains and the location of the N- and C-termini.

Recent structural studies of mouse TTYH2 and TTYH3 using cryo-electron microscopy (cryo-EM) have revealed that these proteins adopt a previously unobserved fold, which includes an extended extracellular domain with a partially solvent-exposed pocket that may serve as an interaction site for hydrophobic molecules . While these studies were conducted on mouse proteins, the high conservation across species suggests similar structural features may be present in zebrafish ttyh3.

The topology of TTYH proteins has been disputed in the scientific literature. For instance, studies on the related TTYH1 protein initially proposed specific arrangements of transmembrane domains, but later experimental evidence from Han et al. demonstrated that both the N- and C-termini were located intracellularly, contradicting earlier predictions from topology prediction software . These findings highlight the challenges in determining the precise structural arrangement of this protein family.

Quaternary Structure and Calcium Binding

An important feature of TTYH proteins revealed by recent structural studies is their calcium-dependent dimerization. In the presence of calcium ions, TTYH2 and TTYH3 form homomeric cis-dimers bridged by extracellularly coordinated calcium . This calcium-dependent change in quaternary structure may be central to the protein's function in cell adhesion and signaling.

Interestingly, in the absence of calcium, TTYH2 has been observed to form trans-dimers that span opposing membranes across approximately 130 Å intermembrane space, as well as existing in a monomeric state . This finding suggests a potential role for these proteins in calcium-dependent cell-cell adhesion or communication across cells.

While these studies were performed with mouse proteins, the calcium-dependent dimerization is likely conserved in Danio rerio ttyh3 given the evolutionary conservation of the Tweety family. This structural feature may be essential to understanding the protein's biological function.

Expression Systems and Conditions

Recombinant Danio rerio ttyh3 has been successfully expressed in Escherichia coli expression systems, as evidenced by commercial availability of the protein . The recombinant protein includes the full-length sequence (amino acids 1-560) fused to an N-terminal histidine tag to facilitate purification . The expression in E. coli suggests that, despite being a membrane protein, ttyh3 can be produced in prokaryotic systems, which is advantageous for large-scale protein production and subsequent functional studies.

The UniProt ID for Danio rerio ttyh3 is Q32LT7, and it is also known by the synonym "zgc:123242" . This database entry provides a reference point for researchers interested in the protein's sequence and annotated features. The successful expression of this membrane protein in bacterial systems represents an important achievement for structural and functional studies.

Reconstitution for Experimental Use

For experimental applications, the lyophilized ttyh3 protein should be briefly centrifuged prior to opening to bring the contents to the bottom of the vial. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended . To enhance stability during long-term storage, adding glycerol to a final concentration of 5-50% (with 50% being the default recommendation) and aliquoting for storage at -20°C/-80°C is advised .

These handling and storage recommendations are critical for maintaining the structural integrity and functionality of the recombinant protein for research applications. Proper reconstitution ensures that the protein maintains its native conformation and activity for downstream experimental use, which is essential for obtaining reliable and reproducible results in structural and functional studies.

Disputed Channel Properties

The functional characterization of TTYH proteins, including ttyh3, has been a subject of significant debate in the scientific literature. Initially, Tweety family proteins were proposed to be gated chloride channels with maxi-anion channel properties, meaning wide-pore channels with large conductance that allow the passage of larger anions such as adenosine triphosphate (ATP) and glutamate .

Specifically, TTYH2 and TTYH3 were described as calcium-dependent channels, while TTYH1 was characterized as calcium-independent . All three were reported to act in a swelling-dependent manner and function as volume-regulated anion channels (VRAC) . These initial characterizations suggested important roles in cellular volume regulation and ion homeostasis.

Alternative Functional Mechanisms

If TTYH proteins, including zebrafish ttyh3, are not ion channels as initially proposed, what might their function be? Recent structural and functional studies suggest several possibilities:

  1. Calcium-dependent changes in quaternary structure: The calcium-dependent formation of cis-dimers and calcium-independent formation of trans-dimers (observed in TTYH2) may be central to the protein's signaling function . These structural changes could mediate cellular responses to calcium signaling events.

  2. Interactions with hydrophobic molecules: The presence of a partially solvent-exposed pocket in the extracellular domain suggests TTYH proteins might interact with hydrophobic molecules near the extracellular membrane surface . This could implicate them in lipid binding or transport functions.

  3. Association with protein partners: TTYH proteins may function through interactions with additional protein partners, as suggested by interactome studies showing potential interactions between TTYH3 and various proteins, including CDKAL1, LMAN2, DHRS9, P2RY12, LPAR1, CD70, and many others . These protein-protein interactions could place ttyh3 within complex signaling networks.

  4. Cell adhesion and migration: The ability to form trans-dimers across membranes suggests potential roles in cell-cell adhesion or communication . This could be particularly important during developmental processes when cells must coordinate their behavior.

These alternative mechanisms point to roles in cell adhesion, migration, and developmental signaling rather than direct ion transport, though the precise function remains to be fully elucidated. The diversity of potential functions highlights the complexity of this protein family and the need for further research.

Developmental Processes

Given that the Tweety family is highly conserved across species, including the presence of ttyh3 in zebrafish, these proteins likely play important roles in developmental processes. The calcium-dependent dimerization and potential for trans-membrane interactions suggest functions in cell-cell communication or adhesion, which are critical during embryonic development.

Zebrafish serve as an excellent model organism for studying vertebrate development due to their transparent embryos and rapid development. The expression of ttyh3 in zebrafish could provide insights into its role during embryogenesis, tissue formation, and organogenesis. While specific developmental roles of zebrafish ttyh3 are not extensively documented in the provided search results, research on the Tweety family more broadly indicates potential involvement in various developmental processes .

The ability of TTYH proteins to form calcium-dependent dimers suggests they may participate in calcium-mediated developmental signaling pathways, which are known to be crucial for proper embryonic development. Further research using zebrafish as a model organism could elucidate the specific developmental processes in which ttyh3 plays a role.

Implications in Disease

Studies of TTYH3 in human disease contexts, particularly in cancer, provide insights into the potential biological significance of this protein family. For instance, TTYH3 has been investigated as a prognostic biomarker in lung adenocarcinoma (LUAD), with findings indicating that its expression is significantly upregulated at both mRNA and protein levels in LUAD compared to normal tissues .

Additionally, TTYH3 expression has been correlated with immune cell infiltration in tumors, showing significant correlations with CD4+ T cells (r = 0.341, p = 1.29e-14), macrophages (r = 0.252, p = 1.77e-08), neutrophils (r = 0.35, p = 2.27e-15), and dendritic cells (r = 0.353, p = 9.68e-16) . This suggests potential roles in immune regulation or tumor microenvironment modulation, which could be relevant for understanding cancer progression and developing therapeutic strategies.

While these studies focused on human TTYH3 rather than zebrafish ttyh3, the high conservation of the protein family suggests potential parallels in function. Understanding the role of ttyh3 in normal zebrafish biology may therefore provide insights into its function in disease contexts across species, potentially contributing to the development of therapeutic approaches targeting TTYH3.

Protein Interactions

Interactome studies have suggested that TTYH3 interacts with various proteins, including CDKAL1, LMAN2, DHRS9, P2RY12, LPAR1, CD70, FAM189A2, FAM134C, GPR141, TMEM206, ASGR2, CD27, PTGIR, S1PR1, SLCD6A1, TNFRSF1A, GYPB, TMEM171, IPPK, and FTR2 . These interactions point to potential roles in diverse cellular processes, including cell adhesion, signaling, and regulation of cell morphology.

Of particular interest is the correlation between TTYH3 and GNA12, with significant positive correlations reported across multiple databases (Spearman: r = 0.66-0.72; Pearson: r = 0.63-0.65) . GNA12 is a G protein subunit known to be involved in various signaling pathways, and its strong correlation with TTYH3 suggests potential functional relationships.

The specific protein interaction partners of zebrafish ttyh3 have not been extensively documented in the provided search results, but the conservation of the protein family suggests potential similar interaction networks across species. Identifying and characterizing these interactions could provide valuable insights into the protein's cellular functions.

Model System Studies

Zebrafish are widely used as model organisms in developmental biology and disease research due to their transparent embryos, rapid development, and genetic similarity to humans. The availability of recombinant zebrafish ttyh3 protein facilitates studies of this protein's function in this important model system.

Researchers can use the recombinant protein for various applications, including raising antibodies for immunohistochemistry or Western blotting, studying protein-protein interactions, and investigating potential binding partners or ligands. The ability to produce and purify recombinant ttyh3 enables detailed biochemical and biophysical studies that would otherwise be challenging with endogenously expressed protein.

Zebrafish models could be particularly valuable for studying the developmental roles of ttyh3, as genetic manipulation techniques such as CRISPR/Cas9 can be readily applied to generate knockout or knockin models. Combined with the availability of recombinant protein, these approaches could provide comprehensive insights into ttyh3 function in vivo.

Therapeutic Potential

The implication of TTYH3 in disease contexts, particularly in cancer, suggests potential therapeutic applications. If TTYH3 plays roles in tumor progression or immune regulation, as suggested by studies in lung adenocarcinoma , it may represent a target for therapeutic intervention.

The correlation between TTYH3 expression and immune cell infiltration in tumors suggests that modulating TTYH3 function could potentially affect the tumor immune microenvironment, which is increasingly recognized as a critical factor in cancer progression and response to immunotherapy. Understanding the structure and function of ttyh3 across species, including zebrafish, can contribute to the development of targeted therapies that modulate its activity or interactions.

The recombinant protein can be used in high-throughput screening assays to identify small molecules that bind to or modulate the protein's function. Such molecules could serve as leads for drug development targeting TTYH3 in various disease contexts.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
ttyh3; zgc:123242; Protein tweety homolog 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-560
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ttyh3
Target Protein Sequence
MAAVVNYSPPWWVNLFHRLPHFNLQFQQTSSDFRPDDSDYQKAVLLLGAAALVCLALDLL FLLFYSFWLCCCRRKNHDSPNADCCCTAWCVIIATLVCSAGIAVGFYGNGETCDGVTRLT YSLRHANQTVAGIDKLVSESTSSLNETLMEGLVQLETVYSKQTDYLSIVQKLQGQLDELI NLMLGVPFWSSNDLSLDHLASITEQYDWYRWLGYLGLLLFDVIICLLVLVGLIRNSRSIL IGVCFLGVLTLVISWASLGLEFSFAVGASDFCVSPDSYITKVTRENAVINQDILQYYLKC SMGQTNPFQQKLSGSHKALVEMQDDVSELLRSAIRDFPKTKSNLEEMQGVLNSTEVSLHH LTALVDCRSLHMDYVQALTGLCYDGVEGLIYLVLFSFVTALMFSSIVCSVPHTWQSKRSE EEDGDETSATLGSRAPHDNLYRVHMPSLYSCGSSTYGNEASLPAAAHTVSNAPVTEYMSQ NANFQTPRCENTPLIGRESPPPSYTSSMRAKYLATSRPDQPRPTESQNGLEPNMRPDLTS RSAPNSRPNSAIHRPHSAIH
Uniprot No.

Target Background

Function

Putative large-conductance Ca2+-activated chloride channel.

Database Links
Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural organization of TTYH3 protein in Danio rerio?

Danio rerio TTYH3 is a conserved transmembrane protein belonging to the Tweety homolog family. The protein consists of 560 amino acids with a molecular structure that includes multiple transmembrane domains and extended extracellular regions . TTYH3 adopts a previously unobserved protein fold that includes an extended extracellular domain with a partially solvent-exposed pocket, which may serve as an interaction site for hydrophobic molecules .

How does TTYH3 differ from other members of the TTYH family?

TTYH3 shares the core structural features with other TTYH family members, but exhibits several distinctive characteristics:

What are the optimal conditions for handling recombinant Danio rerio TTYH3 protein in laboratory settings?

Based on established protocols for recombinant TTYH3 protein:

  • Storage conditions: Store at -20°C for general use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol for stability .

  • Working temperature: When conducting experiments, maintain working aliquots at 4°C for up to one week to minimize protein degradation .

  • Freeze-thaw considerations: Repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and functional loss. It's recommended to prepare small working aliquots upon initial thawing .

  • Buffer compatibility: When designing experiments, consider that TTYH3 functions optimally in physiological pH ranges (7.2-7.6) and requires careful consideration of detergent types if membrane extraction is necessary .

  • Native state preservation: To study the native tetrameric organization, use methods that maintain the protein in a membrane environment, such as lipid nanodiscs, rather than detergent-solubilized preparations that yield predominantly dimeric forms .

What techniques are most effective for studying TTYH3 oligomeric states and structural organization?

Based on successful experimental approaches from recent studies:

TechniqueApplicationKey FindingsLimitations
Cross-linking studiesDetermination of native oligomeric stateRevealed tetrameric organization at cell membraneLimited structural detail
Single-molecule fluorescence microscopyVisualization of protein complexes in intact cellsConfirmed tetrameric assembly at plasma membraneRequires fluorescent tagging
Blue-native PAGEAnalysis of protein complex sizeDemonstrated the effect of detergent on complex stabilityArtificial conditions
Fluorescence-detection size-exclusion chromatographyQuantitative analysis of protein complex sizeTracked the conversion from tetramers to dimersRequires specialized equipment
Hydrogen/deuterium exchange mass spectrometry (HDX-MS)Identification of stabilized regions in complexShowed stabilization of extracellular domains in tetramersComplex data interpretation
Cryo-EMHigh-resolution structural analysisRevealed unique protein fold and Ca²⁺-dependent dimerizationPrimarily captured dimeric forms

For comprehensive analysis of TTYH3 structure and organization, a combination of these techniques is recommended. Cross-linking and single-molecule approaches are particularly valuable for capturing the native tetrameric state, while structural techniques like cryo-EM provide detailed insights into domain organization and interaction interfaces .

What are the current hypotheses regarding TTYH3 function in zebrafish development and physiology?

Current research indicates several potential roles for TTYH3 in zebrafish:

  • Neurodevelopmental functions: Based on knockout studies in mice and expression patterns in zebrafish, TTYH3 likely plays important roles in neurogenesis and brain development . The high conservation of TTYH proteins across vertebrates suggests similar functions in zebrafish neuronal development.

  • Cell adhesion and migration: The unique structural organization of TTYH3, particularly its ability to form different types of dimers (cis- or trans-) depending on calcium levels, suggests potential roles in cell-cell adhesion and cellular migration processes essential for development .

  • Signaling pathway modulation: Recent findings in mammalian systems indicate TTYH3 involvement in signaling pathways like Wnt/β-catenin . These pathways are highly conserved in vertebrates and critical for embryonic development in zebrafish.

  • Membrane organization: The tetrameric complexes formed by TTYH3 at the cell membrane may contribute to membrane domain organization or serve as scaffolds for multi-protein signaling complexes .

It's important to note that while TTYH proteins were previously characterized as chloride channels, recent structural and functional analyses have refuted this role, necessitating reassessment of their physiological functions .

How does TTYH3 function differ between normal developmental processes and pathological conditions?

While research specifically on zebrafish TTYH3 in pathological contexts is limited, comparative studies from mammalian systems reveal significant insights:

In normal development:

  • TTYH3 contributes to neurogenesis and brain development through mechanisms that likely involve cell adhesion, migration, and signaling pathway modulation .

  • The protein forms stable tetrameric complexes at the plasma membrane that may serve as organizational hubs for developmental signaling .

In pathological conditions:

  • TTYH3 overexpression has been associated with cancer progression in several tumor types, including cervical cancer, hepatocellular carcinoma, and cholangiocarcinoma .

  • Mechanistically, TTYH3 has been shown to enhance epithelial-mesenchymal transition (EMT) and activate Wnt/β-catenin signaling in cancer cells .

  • TTYH3 promotes cell proliferation and inhibits apoptosis in cancer contexts, while simultaneously enhancing cellular migration and invasion capabilities .

These differential functions suggest that TTYH3 may adopt context-dependent roles, with its normal developmental functions potentially being coopted during pathological processes. Understanding these mechanistic differences could provide valuable insights for both developmental biology research and potential therapeutic targeting .

What mechanisms govern the calcium-dependent conformational changes in TTYH3 complexes?

The calcium-dependent conformational changes in TTYH3 represent an area of active investigation with several key mechanistic questions:

  • Calcium binding sites: Structural studies of mouse TTYH proteins have revealed that calcium ions are coordinated at the interface between subunits in extracellular domains, serving as bridging elements in cis-dimers . The specific amino acid residues involved in calcium coordination in Danio rerio TTYH3 require further characterization, though conservation analysis suggests similar binding motifs.

  • Conformational switching: In the absence of calcium, TTYH proteins like TTYH2 can form trans-dimers that span opposing membranes, while calcium promotes cis-dimer formation . The structural elements that enable this remarkable conformational plasticity and the energy landscape governing these transitions remain incompletely understood.

  • Allosteric effects: Hydrogen/deuterium exchange mass spectrometry (HDX-MS) has demonstrated that the extracellular domains are stabilized in the context of tetrameric TTYH complexes . This suggests allosteric communication between subunits that may be influenced by calcium binding, potentially serving as a molecular switch for TTYH function.

  • Kinetics of transition: The rate at which TTYH3 complexes respond to changing calcium concentrations and the potential for intermediate conformational states during these transitions remain important questions for future research.

Advanced methodologies combining time-resolved structural techniques with functional assays will be necessary to fully elucidate these calcium-dependent mechanisms and their physiological relevance.

How do post-translational modifications affect TTYH3 localization and function?

Post-translational modifications (PTMs) represent an important regulatory layer for membrane proteins like TTYH3, though this aspect remains underexplored. Based on available data and similar membrane protein systems, several key considerations emerge:

  • Potential modification sites: Analysis of the TTYH3 sequence reveals multiple potential sites for phosphorylation, glycosylation, and other modifications, particularly in the cytoplasmic and extracellular domains .

  • Trafficking regulation: PTMs likely play crucial roles in regulating TTYH3 trafficking to the plasma membrane, with phosphorylation events potentially serving as molecular switches that control protein exit from the endoplasmic reticulum or movement through the secretory pathway.

  • Complex stability: Modifications in the extracellular domains might influence the stability of tetrameric complexes and their calcium sensitivity . For example, glycosylation could affect protein-protein interactions at subunit interfaces.

  • Signaling integration: Cytoplasmic domain modifications could integrate TTYH3 function with cellular signaling networks, particularly in contexts like Wnt pathway activation where TTYH3 has demonstrated functional relevance .

  • Species-specific considerations: When working with Danio rerio TTYH3, researchers should consider potential differences in PTM patterns compared to mammalian orthologs, as these may influence experimental outcomes and interpretation.

This area represents a significant opportunity for future research, with proteomic approaches like mass spectrometry being particularly suitable for comprehensive PTM mapping.

What expression systems are most suitable for producing functional recombinant Danio rerio TTYH3?

Selecting an appropriate expression system is crucial for obtaining functional recombinant TTYH3. Based on the properties of membrane proteins like TTYH3, several expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsConsiderations for TTYH3
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, inclusion body formation common for membrane proteinsSuitable for cytoplasmic domains, but less ideal for full-length TTYH3
Insect cells (Sf9, Sf21)Better membrane protein folding, some PTMsMore expensive than bacterial systems, moderate yieldGood compromise for full-length TTYH3, especially with optimized secretion signals
Mammalian cells (HEK293, CHO)Proper folding, authentic PTMs, native-like membrane environmentHigher cost, lower yield, longer production timeOptimal for functional studies requiring proper TTYH3 tetramerization and activity
Yeast (P. pastoris)High yield, eukaryotic PTMs, scale-up potentialSome differences in glycosylation patternsSuitable for structural studies requiring larger protein quantities
Cell-free systemsRapid, direct access to reaction conditionsLimited membrane incorporation, higher costUseful for domain-specific studies or initial screening

For studies focusing on the native tetrameric organization of TTYH3, mammalian expression systems are generally preferred as they provide the most physiologically relevant environment for proper protein folding and complex formation . For structural studies requiring larger protein quantities, insect cell or yeast expression systems offer a good balance between yield and protein quality.

What are the optimal experimental approaches for investigating TTYH3 interactions with potential binding partners?

Given the emerging understanding that TTYH3 likely functions through interactions with other proteins or small molecules rather than as an ion channel, identifying its binding partners is crucial. Several complementary approaches are recommended:

  • Proximity-based labeling: Techniques such as BioID or APEX2 proximity labeling, where TTYH3 is fused to a biotin ligase or peroxidase, can identify proteins in close proximity to TTYH3 in living cells. This approach is particularly valuable for capturing transient or weak interactions in the native cellular environment.

  • Co-immunoprecipitation with mass spectrometry: Using specific antibodies against Danio rerio TTYH3 (or epitope-tagged versions) followed by mass spectrometry can identify stable interaction partners. To maintain tetrameric complexes, mild solubilization conditions should be employed .

  • Yeast two-hybrid screening: For identifying direct protein-protein interactions, particularly involving cytoplasmic domains of TTYH3. While this approach removes the protein from its membrane context, it can provide valuable initial insights into potential binding partners.

  • FRET/BRET-based interaction assays: By tagging TTYH3 and candidate interactors with fluorescent or bioluminescent proteins, interactions can be monitored in living cells through energy transfer measurements, providing spatial and temporal information about complex formation.

  • Surface plasmon resonance (SPR): For quantitative binding studies between purified TTYH3 (or specific domains) and candidate partners, SPR provides detailed kinetic and affinity information.

  • Cryo-EM of protein complexes: For structural characterization of stable TTYH3 complexes with binding partners, cryo-EM in lipid nanodiscs has proven effective in preserving native-like membrane environments .

When investigating the extracellular pocket identified in TTYH structures as a potential binding site for hydrophobic molecules , specialized techniques like lipid binding assays or small molecule screening approaches may be necessary.

What are common challenges in TTYH3 research and how can they be addressed?

Based on the complex nature of TTYH3 as a membrane protein that forms higher-order oligomers, several technical challenges may arise during research:

  • Maintaining tetrameric organization during purification:

    • Challenge: Detergent solubilization disrupts native tetramers into dimers .

    • Solution: Use lipid nanodiscs or membrane scaffold proteins to maintain a lipid bilayer environment during purification and analysis . Cross-linking prior to solubilization can also help preserve native complexes.

  • Expression and folding issues:

    • Challenge: Membrane proteins often express poorly or misfold in heterologous systems.

    • Solution: Optimize expression conditions by testing different cell types, temperatures, and induction protocols. Consider fusion tags that enhance folding and membrane targeting. For zebrafish TTYH3 specifically, mammalian or insect cell expression systems typically yield better results than bacterial systems.

  • Distinguishing direct vs. indirect effects in functional studies:

    • Challenge: Separating primary TTYH3 functions from secondary effects in cellular contexts.

    • Solution: Combine multiple approaches including acute manipulation (e.g., optogenetic tools) with long-term genetic studies. Include appropriate controls and complementation experiments to confirm specificity.

  • Conflicting data on ion channel activity:

    • Challenge: Historical literature described TTYH proteins as ion channels, but recent structural studies refute this .

    • Solution: When studying TTYH3 function, incorporate multiple methodologies beyond electrophysiology, including structural, biochemical, and cell biological approaches to build a more comprehensive functional model.

  • Species-specific differences:

    • Challenge: Extrapolating findings between zebrafish and mammalian TTYH3.

    • Solution: Perform comparative studies and complement zebrafish in vivo experiments with mammalian cell culture work to identify conserved mechanisms.

How can researchers effectively analyze the role of TTYH3 in developmental and disease models?

TTYH3 functions appear to span both developmental processes and pathological conditions, requiring specialized approaches for comprehensive functional analysis:

  • Developmental models:

    • Zebrafish-specific approaches: Morpholino knockdown, CRISPR/Cas9 genome editing, and transgenic overexpression models can be used to manipulate TTYH3 expression during development.

    • Spatiotemporal considerations: Use tissue-specific or inducible expression systems to control when and where TTYH3 is manipulated, as it may have distinct functions in different developmental contexts.

    • Phenotypic analysis: Combine behavioral assessment with histological analysis and molecular profiling to characterize developmental phenotypes comprehensively.

  • Disease models:

    • Cancer research applications: Based on findings linking TTYH3 to cancer progression through Wnt/β-catenin signaling , researchers can investigate:

      • Expression correlation: Analyze TTYH3 expression levels in tumor samples compared to matched normal tissues.

      • Functional manipulation: Use gain- and loss-of-function approaches to assess TTYH3's contribution to cancer hallmarks like proliferation, migration, and resistance to apoptosis.

      • Signaling pathway analysis: Monitor Wnt/β-catenin pathway activation using reporter systems in conjunction with TTYH3 manipulation.

  • Advanced methodological considerations:

    • Single-cell approaches: Given potential cellular heterogeneity in TTYH3 expression and function, single-cell RNA sequencing and spatial transcriptomics can provide valuable insights.

    • In vivo imaging: For zebrafish models, the optical transparency of embryos allows for real-time imaging of developmental processes and cell behaviors following TTYH3 manipulation.

    • Drug screening platforms: Zebrafish embryos can serve as efficient platforms for identifying compounds that modulate TTYH3 function or downstream effects, potentially revealing therapeutic targets.

  • Translational relevance:

    • Comparative approach: When studying TTYH3 in disease contexts, systematically compare findings across species (zebrafish, mouse, human) to identify conserved mechanisms with therapeutic potential .

    • Patient-derived models: For human disease relevance, complement zebrafish studies with analyses in patient-derived cells or tissues to validate key findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.