Recombinant Danio rerio Protein unc-50 homolog (unc50)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression

UNC50 is produced via recombinant DNA technology, where the zebrafish unc50 gene is cloned and expressed in E. coli. Key production details include:

ParameterSpecification
Expression HostE. coli
TagN-terminal His tag (for purification and stability)
Protein LengthFull-length (1–259 amino acids)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer with 6% trehalose or 50% glycerol (pH 8.0)
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with glycerol for long-term storage

The protein is lyophilized and requires careful handling to avoid repeated freeze-thaw cycles .

Functional Insights and Biological Relevance

UNC50 is essential for AChR trafficking and surface expression, particularly in neuromuscular junctions.

Role in AChR Function

  • Trafficking Mechanism: Binds RNA and facilitates AChR localization to the cell membrane .

  • Disease Association: Biallelic mutations in human UNC50 cause arthrogryposis multiplex congenita (AMC) due to loss of AChR expression, leading to fetal muscle immobility .

Zebrafish-Specific Findings

  • Subcellular Localization: Associates with the nuclear envelope, inner membrane, and intermembrane space .

  • Gene Duplication: Zebrafish have paralogous genes (e.g., unc50a, unc50b) due to genome duplication, with distinct tissue expression patterns .

Research Applications

UNC50 is used in diverse studies, including neurobiology, developmental biology, and immunology.

Experimental Uses

ApplicationDetails
ELISA AssaysDetects UNC50 expression levels in zebrafish tissues (e.g., ovary, liver) .
Gene Function StudiesCRISPR/Cas9 models in C. elegans validate UNC50’s role in AChR expression .
ImmunologyInvestigates germline V(D)J recombination in zebrafish ovaries .

References

  1. Creative Biomart: Recombinant Full-Length Human UNC50 Protein .

  2. NucEnvDB: Zebrafish UNC50 Nuclear Envelope Localization .

  3. PubMed: UNC50 Mutations and AMC .

  4. E-Scape Bio: Zebrafish UNC50 ELISA Kit .

  5. CBM15: Recombinant UNC50 Specifications .

  6. PubMed: Zebrafish CRBPI/II Gene Duplication .

  7. GenScript: UNC50 cDNA ORF Clones .

  8. PMC: Zebrafish Ovary RAG Expression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate this to us. We will prioritize developing the specified tag.
Synonyms
unc50; Protein unc-50 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
unc50
Target Protein Sequence
MLPTSSPQIHRNGSLSERDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQMLYLFTSPQK VYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGLVLDMGFVETLTLLLWVVFIDC IGVGLLISTLMWFVTNKYLMKHPNRDYDVEWGYAFDVHLNAFYPLLVILHFLQLFFINHV VVISSDWFLGYFVGNTMWLIAIGYYVYITFLGYSALPFLKNTVVLLYPFALLGLLYVLSI SLGWNFTKGLCWFYKHRVQ
Uniprot No.

Target Background

Function
Plays a crucial role in the cell surface expression of neuronal nicotinic receptors. Exhibits RNA binding capabilities.
Database Links
Protein Families
Unc-50 family
Subcellular Location
Nucleus inner membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the structure and cellular localization of UNC50 in Danio rerio?

UNC50 in Danio rerio is a 259 amino acid protein that functions as a transmembrane protein. The full amino acid sequence begins with mLPTSSPQIHRNGSLSERDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQ and continues through multiple hydrophobic regions . Structurally, UNC50 is primarily localized to the nuclear envelope, specifically in the nuclear inner membrane that separates the nuclear matrix from the intermembrane space . This membrane localization is consistent with UNC50's transmembrane topology as identified through sequence analysis. In mammalian systems, the inner nuclear membrane is typically associated with heterochromatin and the nuclear lamina, suggesting potential roles in nuclear organization .

What are the known functional roles of UNC50 in cellular processes?

UNC50 appears to have multiple cellular functions. By similarity to mammalian homologs, the zebrafish UNC50 is involved in the cell surface expression of neuronal nicotinic receptors and has RNA-binding capabilities . More broadly, research on UNC50 homologs indicates involvement in protein trafficking pathways. In cancer studies, UNC50 has been shown to activate the EGFR pathway in a ligand-dependent manner, influencing cell cycle progression through the G1/S transition and promoting cellular proliferation . The protein appears to modulate EGFR pathway activity not by altering total EGFR protein or mRNA levels, but rather through post-translational mechanisms that affect receptor function .

How do I store and handle recombinant UNC50 protein for experimental use?

Recombinant UNC50 protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol, which is optimized for this particular protein's stability . For long-term storage, conservation at -80°C is recommended. To maintain protein integrity, repeated freezing and thawing cycles should be avoided as these can lead to protein denaturation and functional loss . When working with the protein, prepare aliquots to minimize freeze-thaw cycles, and working aliquots can be stored at 4°C for up to one week . These storage conditions are critical for maintaining the structural integrity and activity of the recombinant protein for experimental applications.

What techniques can I use to study UNC50 expression in zebrafish tissues?

For studying UNC50 expression in zebrafish tissues, several methodological approaches are effective:

  • Northern Blotting: This technique has been successfully used to detect UNC50 mRNA expression in tissues, with 28S and 18S rRNA bands serving as reference standards .

  • Quantitative PCR: Real-time PCR provides quantitative measurement of UNC50 expression levels. The relative mRNA expression levels should be normalized to housekeeping genes such as β-actin, and fold changes can be calculated using the comparative cycle threshold (ΔΔCt) method .

  • Western Blotting: For protein-level detection, western blotting with specific anti-UNC50 antibodies allows visualization of protein expression patterns across different tissues, with β-actin commonly used as a loading control .

  • Fluorescent Reporter Systems: Based on methodologies used with related zebrafish genes, transgenic approaches using GFP reporters driven by the UNC50 promoter could reveal the spatiotemporal expression pattern in vivo .

When comparing expression between experimental groups, established cutoff values (such as log2-transformed fold changes of ±1) help identify significant changes in expression levels .

How can I assess the functional impact of UNC50 in cellular pathways?

To evaluate UNC50's functional impact on cellular pathways, particularly its role in signaling processes, several approaches are recommended:

  • Phosphorylation Status Analysis: Since UNC50 appears to influence the EGFR pathway, immunoblot assays detecting phosphorylation levels of EGFR (such as at tyrosine 1068) can reveal pathway activation .

  • Expression Manipulation Studies: Creating cell lines with modified UNC50 expression (overexpression or knockdown) allows assessment of dose-dependent effects on downstream targets .

  • Ligand Stimulation Experiments: Testing cells with different UNC50 expression levels under various conditions (serum-free medium, complete medium, or medium supplemented with specific ligands like EGF) can demonstrate ligand-dependency of UNC50 effects .

  • Pathway Inhibition: Using specific inhibitors (like erlotinib for EGFR) in combination with UNC50 manipulation can confirm pathway specificity of observed effects .

  • Downstream Target Analysis: Monitoring changes in downstream targets like cyclin D1 (CCND1) at both mRNA and protein levels provides insight into functional consequences of UNC50 activity .

Controlling for cell density and synchronizing cells through serum starvation before treatments helps minimize variables that might confound results in these functional assays .

What methods are appropriate for studying UNC50's role in cell cycle regulation?

Based on established research, the following methodological approaches are effective for investigating UNC50's influence on cell cycle regulation:

  • Flow Cytometry Analysis: This technique allows precise determination of cell cycle distribution after synchronizing cells in G0 phase through serum starvation. Comparing cells with different UNC50 expression levels following release from G0 arrest (with serum stimulation, with or without growth factors like EGF) reveals UNC50's impact on cell cycle progression .

  • Cell Proliferation Assays: MTT assays provide quantitative measurement of cell proliferation states under various conditions. When studying UNC50's effects, regularly refreshing culture medium with consistent levels of growth factors (e.g., 1 ng EGF every 12 hours) helps maintain stable stimulation throughout the experiment .

  • Cyclin Expression Analysis: As UNC50 has been shown to influence expression of cell cycle regulators like cyclin D1, monitoring both mRNA and protein levels of cyclins provides mechanistic insight into how UNC50 affects the G1/S transition .

  • Pathway Inhibitor Studies: Combining UNC50 expression manipulation with specific pathway inhibitors (such as erlotinib for EGFR) helps establish whether UNC50's cell cycle effects depend on specific signaling pathways .

When designing these experiments, careful consideration of control conditions and time points is essential, as UNC50's effects may be more pronounced under specific stimulation conditions rather than standard culture conditions .

What evidence links UNC50 to cancer development?

Research has established several lines of evidence linking UNC50 to cancer development, particularly in hepatocellular carcinoma (HCC):

  • Expression Upregulation: UNC50 has been found significantly upregulated in HCC tissues compared to adjacent non-cancerous tissues. Quantitative PCR analysis revealed that approximately 45.5% of HCC cases showed significant UNC50 upregulation, while only 4.5% showed reduced expression .

  • Protein Expression Pattern: Western blotting demonstrated that UNC50 protein was detectable in 11 of 12 cancer tissues but only in 6 of 12 non-cancerous tissues, indicating consistent protein-level upregulation in malignant states .

  • Meta-analysis Confirmation: Systematic review of 16 independent microarray experiments from the GEO database further confirmed significant upregulation of UNC50 in HCC tissues compared to paired adjacent non-cancerous liver tissues (p = 0.005) .

  • Functional Impact on Proliferation: Experimental manipulation of UNC50 expression levels demonstrated its ability to influence cell cycle progression and proliferation through effects on the EGFR pathway, suggesting a mechanism by which UNC50 could contribute to cancer development .

  • EGFR Pathway Activation: UNC50 was shown to activate the EGFR pathway in a ligand-dependent manner, enhancing downstream signaling that promotes cell proliferation - a hallmark characteristic of cancer development .

These findings collectively establish UNC50 as a potential contributor to cancer development through its effects on cellular signaling and proliferation mechanisms.

How does UNC50 influence the EGFR signaling pathway?

UNC50's influence on the EGFR signaling pathway appears to operate through post-translational mechanisms rather than by altering receptor expression levels:

This evidence suggests that UNC50 may function as a modulator of EGFR receptor function, potentially influencing its localization, activation kinetics, or interaction with downstream signaling components.

How does UNC50 function compare between zebrafish and mammalian systems?

While research specifically comparing zebrafish and mammalian UNC50 function is limited in the provided references, several key similarities and potential differences can be identified:

  • Structural Conservation: The zebrafish UNC50 protein shares functional homology with mammalian counterparts, suggesting evolutionary conservation of basic structural features .

  • Subcellular Localization: In both zebrafish and mammalian systems, UNC50 is localized to the nuclear envelope, specifically at the nuclear inner membrane . This conserved localization suggests similar fundamental cellular roles across species.

  • Receptor Trafficking: By similarity to mammalian homologs, zebrafish UNC50 is involved in the cell surface expression of neuronal nicotinic receptors . This functional conservation suggests a preserved role in membrane protein trafficking across vertebrate species.

  • RNA Binding: The zebrafish UNC50, like its mammalian counterparts, appears to have RNA-binding capabilities , indicating conservation of molecular interactions.

  • Pathway Involvement: Studies in human cell lines demonstrate UNC50's involvement in the EGFR pathway and cell cycle regulation . While not directly confirmed in zebrafish models, the conservation of these signaling pathways across vertebrates suggests potential similar functions.

The conservation of basic molecular characteristics and cellular localization patterns between zebrafish and mammalian UNC50 makes the zebrafish model valuable for investigating fundamental aspects of UNC50 biology that may translate to mammalian systems, while recognizing that species-specific differences in regulatory networks may exist.

What can we learn from zebrafish UNC50 studies that applies to human disease research?

Zebrafish UNC50 studies offer several valuable insights applicable to human disease research:

  • Cancer Biology Models: The demonstrated role of UNC50 in cell proliferation and EGFR pathway activation in human cancer cells suggests that zebrafish models could be developed to study UNC50's role in tumor development in vivo, potentially revealing conserved oncogenic mechanisms.

  • Developmental Function: Given the established utility of zebrafish for developmental studies, investigating UNC50's role during zebrafish development could provide insights into potential developmental functions relevant to human congenital disorders.

  • Neurological Applications: The involvement of UNC50 in cell surface expression of neuronal nicotinic receptors suggests potential relevance to neurological disorders involving cholinergic signaling. Zebrafish models are increasingly used for neurological disease research and could provide accessible systems for studying these mechanisms.

  • Drug Discovery Platform: Zebrafish models with manipulated UNC50 expression could serve as platforms for screening compounds that modulate UNC50 function or downstream pathways, potentially identifying therapeutic candidates for UNC50-related human diseases.

  • Translational Research: The availability of recombinant zebrafish UNC50 protein facilitates structural and functional studies that could inform development of targeted therapies applicable to human disease contexts where UNC50 plays a role.

The genetic tractability, optical transparency, and rapid development of zebrafish make them valuable models for investigating UNC50 biology in contexts relevant to human disease, bridging basic molecular understanding with potential clinical applications.

How can I design effective genetic manipulation strategies for UNC50 in zebrafish?

Designing effective genetic manipulation strategies for UNC50 in zebrafish requires consideration of several methodological approaches:

  • Promoter Selection: For expression studies, the identified 503-bp muscle-specific zebrafish promoter (503unc) demonstrates high efficiency in driving gene expression throughout zebrafish musculature . While this promoter is associated with UNC-45b rather than UNC50, it illustrates the principle of using compact tissue-specific promoters for targeted expression studies in zebrafish.

  • CRISPR/Cas9 Genome Editing: For loss-of-function studies, CRISPR/Cas9 targeting of the unc50 gene enables creation of precise knockout or knockin mutations. Guide RNA design should target early exons to ensure complete functional disruption, with careful attention to potential off-target effects.

  • Morpholino Knockdown: Morpholino antisense oligonucleotides can be designed to block unc50 translation or splicing for transient knockdown. These should be carefully validated with rescue experiments using recombinant UNC50 protein or mRNA to confirm specificity.

  • Transgenic Reporter Systems: Based on strategies used for related genes, GFP reporters driven by the endogenous unc50 promoter can recapitulate the native expression pattern, allowing visualization of spatiotemporal expression dynamics in living embryos .

  • Conditional Expression Systems: Gal4/UAS or Cre/loxP systems permit conditional and tissue-specific manipulation of UNC50 expression, allowing investigation of stage-specific or tissue-specific functions while avoiding potential early developmental lethality.

When designing these manipulation strategies, consideration of the transmembrane nature of UNC50 is important, as this may influence protein folding, subcellular localization, and functional outcomes in overexpression or rescue experiments.

What emerging technologies could advance UNC50 functional studies?

Several emerging technologies hold promise for advancing UNC50 functional studies:

  • Single-Cell Transcriptomics: This approach can reveal cell-type specific expression patterns of UNC50 and co-expressed genes across developmental stages or disease states, providing insights into cellular contexts where UNC50 functions.

  • Proximity Labeling Proteomics: Techniques like BioID or APEX2 could identify proteins in close proximity to UNC50 within the nuclear membrane environment, revealing potential interaction partners and functional complexes.

  • Live Imaging of Protein Trafficking: CRISPR-mediated endogenous tagging of UNC50 with fluorescent proteins combined with high-resolution live imaging could track UNC50's dynamics within cellular compartments, particularly in relation to receptor trafficking processes.

  • Cryo-Electron Microscopy: This technique could elucidate the structural details of UNC50 within membrane environments, particularly given its transmembrane topology , providing insights into functional mechanisms.

  • Nanobody-Based Protein Manipulation: Development of UNC50-specific nanobodies could enable acute manipulation of protein function in specific subcellular compartments, allowing temporal precision in functional studies.

  • Optogenetic Control: Engineering light-responsive domains into UNC50 could allow spatiotemporal control of its function, enabling precise investigation of its role in dynamic cellular processes like cell cycle progression that were identified in previous studies .

These technologies could overcome current limitations in understanding UNC50's specific molecular mechanisms, particularly regarding its transmembrane functions and protein-protein interactions within the nuclear membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.