Recombinant Danio rerio Protein YIF1A (yif1a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please specify them when placing the order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yif1a; zgc:73136; Protein YIF1A; YIP1-interacting factor homolog A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MNFQQQGYRATKPRARASPPTGGPMLFDDTSSGPPPMNNQNYYSSGYNMAEMPAGGQEPG VGNIFADPMANAAMMYGSTLANQGKDIVNKEINRFMSVNKLKYFFAVDTKYVMKKLLLLM FPYTHQDWEVRYHRDTPLTPRHDVNAPDLYIPTMAFITYILLAGMALGIQKRFSPEVLGL CASTALVWMIIEVLVMLLSLYLLTVHTDLSTFDLVAYSGYKYVGMILTVFCGLLFGSDGY YVALAWSSCALMFFIVRSLKMKILSSISADSMGAGASAKPRFRLYITVASAAFQPFIIYW LTAHLVR
Uniprot No.

Target Background

Function
Possible role in transport between the endoplasmic reticulum and Golgi apparatus.
Database Links

KEGG: dre:334982

STRING: 7955.ENSDARP00000018303

UniGene: Dr.412

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is YIF1A and what is its significance in Danio rerio research?

YIF1A (Yip1 interacting factor homolog A) is a membrane trafficking protein belonging to the Yip1 domain family. In zebrafish (Danio rerio), the YIF1A protein is encoded by the yif1a gene, also identified as zgc:73136 . This protein plays an important role in cellular membrane trafficking processes. Zebrafish YIF1A shares significant homology with mammalian YIF1A proteins, making it valuable for comparative studies across vertebrate species . As a model organism, zebrafish offers advantages for studying YIF1A function due to its transparent embryos and rapid development, allowing for real-time visualization of protein localization and function during development.

How should recombinant YIF1A protein be stored and handled to maintain optimal activity?

For optimal preservation of recombinant Danio rerio YIF1A:

Storage ConditionRecommendationNotes
Short-term storage4°CUp to one week for working aliquots
Standard storage-20°CFor regular research use
Long-term storage-80°CFor extended preservation
Important cautionAvoid repeated freeze-thaw cyclesCan lead to protein degradation

The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability . For experimental manipulations, it's advisable to thaw the protein on ice and prepare working aliquots to minimize freeze-thaw cycles. The general shelf life for liquid formulations is approximately 6 months at -20°C/-80°C, while lyophilized forms may remain stable for up to 12 months under proper storage conditions .

What expression systems are used to produce recombinant Danio rerio YIF1A, and how does this affect protein functionality?

Recombinant Danio rerio YIF1A is typically produced using in vitro E. coli expression systems . The protein is often supplied with an N-terminal tag (such as 10xHis) to facilitate purification while minimizing interference with protein function .

When designing experiments, researchers should consider:

  • The influence of the expression system on protein folding and post-translational modifications

  • The potential impact of purification tags on protein activity

  • Whether the recombinant protein accurately represents the native conformation

For critical functional studies, researchers may need to verify that the E. coli-expressed protein exhibits expected biological activities through functional assays before proceeding with complex experiments .

What methodologies are most effective for studying YIF1A protein-protein interactions in zebrafish models?

Several approaches have proven effective for investigating YIF1A interactions in zebrafish:

  • Proximity-dependent biotin labeling: TurboID-based methods developed for zebrafish allow for in vivo mapping of protein interactions with subcellular resolution. This technique can be applied to YIF1A by fusing TurboID to the protein and identifying biotinylated proximal proteins via mass spectrometry .

  • GFP-directed proximity labeling: For researchers using existing GFP-tagged zebrafish lines, a GBP (GFP-binding peptide) fused to TurboID enables protein interaction studies without creating new genetic constructs. This modular system is particularly valuable for studying YIF1A interactions beyond embryonic stages .

  • Sequential immunofluorescence and immunohistochemistry: This technique allows precise localization of YIF1A with potential interaction partners at the single-cell level in zebrafish embryos, enabling detailed co-localization studies in three-dimensional space .

The choice of method depends on specific research questions, available resources, and whether you're interested in stable or transient interactions with YIF1A.

How can stable isotope labeling be used to measure YIF1A synthesis and turnover rates in zebrafish tissues?

Stable isotope labeling approaches have been successfully applied to measure protein synthesis rates in zebrafish and can be adapted for studying YIF1A dynamics:

  • Incorporate a stable isotope-labeled amino acid (e.g., [(2)H7]L-leucine) into zebrafish diet at 30-50% replacement levels

  • After defined time periods, extract proteins from tissues of interest (even individual zebrafish hearts provide sufficient material)

  • Perform mass spectrometry analysis to determine the incorporation rate of labeled amino acids into YIF1A

  • Calculate synthesis rates based on the ratio of labeled to unlabeled peptides

This methodology has successfully measured synthesis rates for hundreds of proteins simultaneously in zebrafish cardiac tissue and can be optimized for membrane proteins like YIF1A . The approach is particularly valuable for studying how YIF1A turnover may change during development or under different experimental conditions.

What are the most effective strategies for YIF1A gene knockdown or knockout in zebrafish, and what phenotypes have been observed?

While the search results don't provide specific information about YIF1A knockdown/knockout in zebrafish, several established approaches can be applied:

  • Morpholino oligonucleotides: Similar to YY1a knockdown studies in zebrafish, antisense morpholinos targeting the translation start site or splice junctions of yif1a mRNA can achieve transient knockdown during embryonic development .

  • CRISPR/Cas9 genome editing: This technique has been successfully used to generate mutations in zebrafish genes like acta1b, creating stable knockout lines. For YIF1A studies, CRISPR targeting can be validated using high-resolution melt analysis to distinguish wild-type sequences from mutants .

Based on knowledge of membrane trafficking proteins, potential phenotypes from YIF1A disruption might include defects in:

  • Intracellular vesicle transport

  • Golgi structure and function

  • Protein secretion pathways

  • Embryonic development if the protein has critical developmental functions

When designing knockdown/knockout experiments, researchers should include appropriate controls and rescue experiments to confirm specificity of observed phenotypes.

How does Danio rerio YIF1A compare functionally to its mammalian homologs, and what implications does this have for translational research?

Comparing zebrafish YIF1A to mammalian homologs reveals important evolutionary insights:

FeatureZebrafish YIF1AMammalian YIF1ASignificance
Gene locationSingle copy geneChromosome 11 (humans)Gene conservation across vertebrates
ExpressionMultiple tissuesHighest in duodenum and liverConserved expression patterns
FunctionMembrane traffickingMembrane trafficking with Yip1 domainFunctional conservation
DomainsTransmembrane regionsTransmembrane regions with conserved residuesStructural conservation

What experimental designs best leverage zebrafish YIF1A for modeling human membrane trafficking disorders?

To effectively use zebrafish YIF1A for modeling human conditions:

  • Generate point mutations in conserved domains: Introduce mutations corresponding to human disease variants in conserved regions of zebrafish YIF1A using CRISPR/Cas9 precision editing.

  • Employ rescue experiments: Test functional conservation by determining if human YIF1A can rescue zebrafish phenotypes, similar to how mouse Nanog can rescue zebrafish Nanog depletion .

  • Utilize protein replacement strategies: Evaluate functional equivalence by replacing dietary fish proteins with alternative sources while monitoring effects on YIF1A expression and function .

  • Apply recombinant protein as intervention: Administration of recombinant proteins has shown efficacy in zebrafish models, as demonstrated with zebrafish interferon (zfrIFN1), suggesting potential therapeutic applications for recombinant YIF1A in appropriate disease models .

  • Combine with live imaging: Leverage zebrafish embryo transparency to monitor trafficking dynamics in real-time using fluorescently tagged YIF1A variants.

These approaches maximize the translational potential of zebrafish YIF1A research while acknowledging the limitations of cross-species modeling.

How might recombinant YIF1A be used in proximity labeling proteomics to map the zebrafish membrane trafficking interactome?

Recombinant YIF1A can be leveraged for proximity labeling studies using the following methodology:

  • Generate a fusion protein combining YIF1A with a proximity labeling enzyme (TurboID, MiniTurbo, or BASU)

  • Express the fusion protein in zebrafish embryos through mRNA injection or create stable transgenic lines

  • Administer biotin to initiate proximity-dependent biotinylation of proteins near YIF1A

  • Harvest embryos at various developmental stages and isolate biotinylated proteins

  • Identify biotinylated proteins by mass spectrometry to map the YIF1A interactome

This approach offers several advantages:

  • Captures both stable and transient interactions

  • Works in native cellular environments

  • Can be temporally controlled by biotin administration

  • Achieves subcellular resolution of interaction networks

For membrane proteins like YIF1A, proximity labeling is particularly valuable as it can identify interactions that may be lost during traditional immunoprecipitation approaches due to the hydrophobic nature of membrane protein interactions.

What are the implications of YIF1A research for understanding evolutionary conservation of membrane trafficking machinery?

YIF1A research in zebrafish provides valuable insights into the evolutionary conservation of membrane trafficking:

  • The conservation of YIF1A across vertebrates from teleost fish to mammals suggests that fundamental membrane trafficking mechanisms have been maintained throughout vertebrate evolution .

  • Comparative studies between zebrafish YIF1A and homologs in other species can reveal:

    • Core conserved domains essential for function

    • Species-specific adaptations that may reflect different physiological needs

    • Evolutionary constraints on membrane trafficking proteins

  • The YIF1A research parallels findings with other proteins like Nanog, where functional conservation exists across species despite sequence divergence in some regions .

  • Understanding this evolutionary conservation helps researchers distinguish between essential trafficking mechanisms and species-specific adaptations, potentially revealing new therapeutic targets for membrane trafficking disorders.

By studying YIF1A across species, researchers gain a deeper understanding of both the fundamental and specialized aspects of membrane trafficking throughout vertebrate evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.