Recombinant Danio rerio Protein YIPF3 (yipf3)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

YIPF3 is a 344-amino-acid protein (Uniprot ID: Q803Z2) with structural features including five transmembrane domains and cytosolic N-terminal regions containing conserved LIR (LC3-interacting region) motifs . Recombinant variants are engineered for research purposes, often with tags (e.g., His-tag) or truncated sequences to facilitate purification and functional studies.

PropertyDetails
Source OrganismDanio rerio (zebrafish)
Expression SystemsYeast, E. coli
Purity>85% (SDS-PAGE)
Protein LengthFull-length (1–344 aa) or partial (varies by product)
Tag InformationN-terminal 10xHis-tag (full-length) ; tag type varies (partial)

Production and Recombinant Forms

YIPF3 is produced via recombinant DNA technology, with variations in expression systems and sequence truncations. Key commercial products include:

  • Yeast vs. E. coli: Yeast systems may better replicate native post-translational modifications, while E. coli offers higher yield and simpler purification .

  • Full-Length vs. Partial: Full-length variants (e.g., CSB-CF772100DIL) retain complete structural integrity, critical for functional studies .

Functional Insights and Research Findings

YIPF3, in complex with YIPF4, regulates Golgiphagy—a specialized autophagy pathway targeting Golgi membranes.

Mechanism of Action

  1. ATG8 Binding via LIR Motifs:

    • YIPF3 interacts with ATG8-family proteins (e.g., GABARAP, LC3) through cytosolic LIR motifs, enabling Golgi membrane engulfment by autophagosomes .

    • Phosphorylation of residues upstream of LIR motifs (e.g., Ser45/Ser46) enhances ATG8 binding and Golgiphagy flux .

  2. Dependence on YIPF4:

    • YIPF3 stability and function require YIPF4; co-expression is necessary to maintain Golgiphagy activity .

    • YIPF3 degradation during starvation is lysosome-dependent and mediated by FIP200 (ATG17) .

  3. Golgi Proteome Regulation:

    • In neuronal differentiation models, YIPF3-YIPF4 deficiency leads to Golgi protein accumulation, mirroring defects in ATG12-deficient cells .

Applications in Research

  • Golgiphagy Studies: Truncated YIPF3 variants (e.g., LIR mutants) are used to dissect LIR-ATG8 interactions .

  • Neurological Models: Full-length YIPF3 aids in studying Golgi dynamics during neuronal differentiation .

  • Autophagy Receptor Characterization: Comparative analysis with other receptors (e.g., TEX264) highlights specificity in organelle degradation pathways .

Research Gaps and Future Directions

  • Redundant Pathways: Partial suppression of Golgiphagy in YIPF3/YIPF4 knockouts suggests unknown receptors .

  • Stress-Responsive Regulation: Mechanisms governing YIPF3-YIPF4 activity under ER stress or nutrient deprivation remain unexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us and we will prioritize developing it for you.
Synonyms
yipf3; zgc:55279; Protein YIPF3; YIP1 family member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
yipf3
Target Protein Sequence
MSASQGSKNTNAEPWGGFDDNIIQGTGSAVIDMENMDDTSGSSFEDVGEMHQRMREEEEV TAEAAATEEDNGEYGEFLGMKGLKGQLGRQVADEVWQAGKRQASKAFNLYANIDILRPYF DVEPIQVRNRLVESLIPVRMINFPQKVAGELYGPMMLVFTLVAILLHGMKTSGTVIREGT LMGTAIGTGFGYWLGVSSFIYFLAYLCNAQITMLQMLSLLGYGLFGHCVVLFITYNVHFH SLFYLLWMVIGGLSTLRMVAVLISRTVGQTPRLILCGSLAALHMLFLLYLHFAYHKMVEG ILDTLEGPNIPPIQRVARDVPVVASAVVNATVKSIAAIVQSQQL
Uniprot No.

Target Background

Function
YIPF3 plays a critical role in maintaining the structure of the Golgi apparatus. It may also be involved in hematopoiesis.
Database Links
Protein Families
YIP1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is YIPF3 protein and why is it studied in zebrafish models?

The zebrafish model offers several key advantages for protein research:

  • Rapid development and transparent embryos allowing for in vivo visualization

  • Cost-effectiveness compared to mammalian models

  • Genetic tractability with established genome editing techniques

  • Extensive homology with human genes enabling translational research

The fully mapped zebrafish genome allows researchers to make meaningful comparisons with human gene function, providing critical insights into molecular mechanisms that may be conserved across species . This makes zebrafish YIPF3 studies potentially valuable for understanding cellular trafficking processes in normal development and disease states.

What expression systems are optimal for producing recombinant zebrafish YIPF3?

The choice of expression system for recombinant zebrafish YIPF3 depends on research objectives, required protein quality, and available resources. Three primary systems are commonly used, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coli- Rapid growth
- High protein yields
- Cost-effective
- Established protocols
- Limited post-translational modifications
- Potential folding issues
- Potential inclusion body formation
- Basic binding studies
- Antibody production
- Structural studies requiring high yields
Yeast- Eukaryotic protein processing
- Moderate cost
- Post-translational modifications
- Secretion capabilities
- Lower yields than E. coli
- More complex cultivation
- Potential hyperglycosylation
- Functional studies
- Protein-protein interactions
- Applications requiring glycosylated protein
Mammalian Cells- Most authentic modifications
- Native-like folding
- Complex glycosylation
- Highest cost
- Lowest yields
- Technically demanding
- Critical functional studies
- Drug discovery applications
- When authentic structure is essential

The yeast expression system represents a valuable middle ground, integrating the advantages of mammalian cell expression systems while offering better economic efficiency . It allows for modifications such as glycosylation, acylation, and phosphorylation that may be essential for YIPF3's native function.

What are the optimal storage and handling protocols for recombinant YIPF3?

Proper storage and handling of recombinant YIPF3 is critical for maintaining protein integrity and experimental reproducibility. The following protocols are recommended based on established practices:

Reconstitution Protocol:

  • Centrifuge the lyophilized protein vial briefly to collect contents at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is standard) as a cryoprotectant

  • Aliquot into single-use volumes to prevent repeated freeze-thaw cycles

Storage Conditions:

  • Long-term storage: -20°C to -80°C in aliquots

  • Working stocks: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles, which significantly degrade protein quality

Quality Control Measures:

  • Verify protein integrity by SDS-PAGE before experimental use

  • Assess activity/functionality after extended storage periods

  • Monitor for signs of degradation or aggregation

Following these protocols helps ensure experimental consistency and reliable results when working with recombinant YIPF3 protein. The addition of stabilizing agents such as glycerol is particularly important for membrane-associated proteins like YIPF3, which may have a greater tendency toward aggregation due to hydrophobic domains .

How can CRISPR-Cas9 gene editing be used to study YIPF3 function in zebrafish?

CRISPR-Cas9 technology offers powerful approaches for investigating YIPF3 function in zebrafish models through several sophisticated experimental designs:

Gene Knockout Strategy:

  • Design sgRNAs targeting early exons of the yipf3 gene

  • Introduce frameshift mutations to create premature stop codons

  • Validate knockout efficiency through RT-PCR, Western blotting, and sequencing

  • Analyze phenotypic consequences across developmental stages and tissue types

Domain-Specific Editing:

  • Engineer precise mutations in functional domains to disrupt specific activities

  • Create truncation variants to determine domain-specific contributions

  • Introduce fluorescent protein tags for live visualization of YIPF3 localization

  • Compare phenotypes of domain-specific mutations to complete knockout

Conditional Approaches:

  • Implement tissue-specific or inducible CRISPR systems

  • Utilize split-Cas9 or dCas9 regulatory systems for temporal control

  • Employ homology-directed repair to introduce loxP sites for Cre-mediated control

  • Generate mosaic F0 embryos for rapid preliminary phenotypic screening

The transparency of zebrafish embryos makes them particularly valuable for visualizing the effects of YIPF3 manipulation in real-time during development . Combined with the significant genetic homology between zebrafish and humans, CRISPR-Cas9 modifications of YIPF3 can provide insights relevant to human biology and disease mechanisms.

What functional assays are most informative for characterizing YIPF3 activity?

Characterizing YIPF3 function requires multiple complementary approaches that address different aspects of its cellular activity:

Membrane Trafficking Assays:

  • Vesicle transport tracking using fluorescently labeled cargo proteins

  • Colocalization studies with compartment-specific markers (Golgi, ER, endosomes)

  • Fluorescence recovery after photobleaching (FRAP) to assess dynamic membrane association

  • Live cell imaging of GFP-tagged YIPF3 in zebrafish embryos

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation with putative interaction partners

  • Proximity ligation assays to confirm interactions in situ

  • Yeast two-hybrid screening to identify novel binding partners

  • Pull-down assays using purified recombinant YIPF3

Functional Rescue Experiments:

  • Complementation of YIPF3 knockout with wild-type or mutant variants

  • Cross-species rescue using human YIPF3 in zebrafish knockouts

  • Structure-function analysis through domain deletion or substitution

  • Rescue of trafficking defects in YIPF3-depleted cultured cells

These multifaceted approaches provide comprehensive insights into YIPF3's molecular functions and biological roles. The zebrafish model is particularly valuable for connecting molecular-level observations to whole-organism phenotypes, offering a bridge between in vitro mechanistic studies and potential disease relevance .

How relevant are zebrafish YIPF3 studies to human disease mechanisms?

Zebrafish YIPF3 studies offer significant translational potential for understanding human disease mechanisms due to several key factors:

Neurological Disease Applications:

  • Zebrafish are established models for various neurological disorders including Parkinson's disease

  • Membrane trafficking proteins like YIPF3 may have roles in neurodegenerative processes

  • Similar blood-brain barrier development between zebrafish and humans enhances translational value

  • Behavioral phenotyping in zebrafish can identify neurological dysfunction resulting from YIPF3 alterations

Developmental Disorder Insights:

  • Transparent embryos allow visualization of YIPF3's role in organogenesis

  • Developmental phenotypes may correlate with human congenital disorders

  • High-throughput screening capability enables efficient testing of genetic and pharmacological interventions

The zebrafish model bridges the gap between in vitro cellular studies and mammalian models, offering sufficient complexity to model human biology while maintaining experimental tractability and cost-effectiveness. This positions zebrafish YIPF3 research as a valuable stepping stone in translational research pathways .

What approaches can integrate zebrafish YIPF3 findings with clinical research?

Several strategic approaches can enhance the translational impact of zebrafish YIPF3 research:

Comparative Genomics Approach:

  • Identify human YIPF3 variants in clinical databases

  • Introduce equivalent mutations into zebrafish yipf3 using CRISPR-Cas9

  • Characterize resulting phenotypes and correlate with human clinical presentations

  • Validate findings in patient-derived cells or other mammalian models

Drug Discovery Pipeline:

  • Develop high-throughput screening assays in YIPF3-mutant zebrafish

  • Screen compound libraries for phenotypic rescue

  • Identify targets and mechanisms of successful compounds

  • Progress promising candidates to mammalian preclinical testing

Multi-Model Validation Strategy:

  • Confirm key findings from zebrafish in mammalian cells and/or mouse models

  • Compare protein interactions and trafficking mechanisms across species

  • Identify conserved and divergent aspects of YIPF3 function

  • Focus translational efforts on highly conserved pathways

Biomarker Development:

  • Identify molecular signatures associated with YIPF3 dysfunction in zebrafish

  • Evaluate candidate biomarkers in patient samples

  • Develop assays for monitoring disease progression or treatment response

  • Correlate zebrafish and human biomarker patterns

These integrative approaches maximize the clinical relevance of zebrafish YIPF3 research, potentially accelerating the pathway from basic science discoveries to therapeutic development for conditions involving vesicular trafficking defects .

What are common challenges in obtaining soluble recombinant zebrafish YIPF3?

Producing soluble recombinant zebrafish YIPF3 presents several technical challenges that researchers should anticipate and address:

Membrane Protein Solubility Issues:

  • YIPF3 contains hydrophobic transmembrane domains prone to aggregation

  • Expression often results in inclusion bodies, particularly in E. coli systems

  • Proper folding may require membrane-like environments

Optimization Strategies:

When working with particularly challenging constructs, researchers might consider expressing truncated versions of YIPF3 (excluding highly hydrophobic regions) while ensuring that the regions essential for the intended application are retained. Alternatively, the yeast expression system may provide better results for full-length YIPF3 due to its eukaryotic protein processing capabilities .

How can researchers validate the functional integrity of purified YIPF3?

Confirming that purified recombinant YIPF3 retains its native structure and function is crucial for experimental validity. Multiple complementary approaches should be employed:

Structural Integrity Assessment:

  • Circular dichroism spectroscopy to verify secondary structure elements

  • Size exclusion chromatography to confirm monomeric state vs. aggregation

  • Thermal shift assays to evaluate protein stability

  • Limited proteolysis to assess proper folding

Functional Verification:

  • Binding assays with known interaction partners

  • Liposome association assays for membrane incorporation

  • Comparison of activity metrics between different expression systems

  • Activity retention after freeze-thaw cycles or extended storage

Quality Control Standards:

  • SDS-PAGE with Coomassie staining should show >90% purity

  • Western blotting with anti-His and anti-YIPF3 antibodies to confirm identity

  • Mass spectrometry to verify sequence and detect modifications

  • Batch-to-batch consistency testing for reproducible results

These validation steps are particularly important when transitioning between expression systems or when modifying purification protocols. For membrane proteins like YIPF3, functional integrity is often dependent on proper incorporation into a lipid environment, which may require additional reconstitution steps beyond standard purification procedures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.