Recombinant Danio rerio Protein YIPF5 (yipf5)

Shipped with Ice Packs
In Stock

Description

Definition and Gene Background

Recombinant Danio rerio YIPF5 is a full-length protein (1-257 amino acids) fused with an N-terminal His tag for purification, expressed in Escherichia coli . The YIPF5 gene (UniProt ID: Q6P5I8) encodes a member of the Yip1 domain family, which is evolutionarily conserved across species, including humans, mice, and zebrafish . Synonyms for this protein include SMAP-5, zgc:56513, and zgc:77939, reflecting its historical identification in genetic studies .

Table 1: Gene Information

PropertyDetail
OrganismDanio rerio (Zebrafish)
Gene Symbolyipf5
UniProt IDQ6P5I8
Protein Length257 amino acids
AliasesSMAP-5, zgc:56513, zgc:77939
Encoded FunctionIntracellular transport between ER and Golgi apparatus

Functional Role in Cellular Pathways

YIPF5 facilitates transport between the ER and Golgi, acting as a Rab GTPase-interacting factor . While specific pathways remain under investigation, it is implicated in:

  • Vesicle budding and fusion: Mediates cargo protein sorting.

  • Membrane trafficking: Maintains Golgi structural integrity .

Table 3: Known Interacting Proteins

FunctionAssociated Proteins
Molecular FunctionLINGO3, UFSP1, LRRC8E, VPS51
Transport RegulationRab GTPases (implied by structural homology)

Research Applications

Recombinant YIPF5 is a key reagent in diverse experimental workflows:

  • Antibody Development: Polyclonal antibodies against YIPF5 are validated for Western blot (WB), immunohistochemistry (IHC), and ELISA .

  • Mechanistic Studies: Used to elucidate ER-Golgi transport defects in model organisms .

  • Diagnostic Assays: Commercial ELISA kits utilize this protein for quantitative analyses .

Table 4: Antibody Validation Data

ApplicationHostReactivityCatalog Number
WB, IHC (p)RabbitHuman, MouseABIN653506
ELISA, IFRabbitHumanABIN7166346
WBRabbitZebrafish, XenopusABIN6747764

Future Directions

Current research gaps include elucidating YIPF5’s role in disease models, such as neuromuscular disorders linked to ER-Golgi dysregulation. Further structural studies using cryo-EM could reveal mechanistic details of its transmembrane domains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yipf5; zgc:56513; zgc:77939; Protein YIPF5; YIP1 family member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
yipf5
Target Protein Sequence
MSGFDNFNTDFYQSSYSVDDQNQGGYGYSNTDEPYKPYGQYDYSQPMGYSAAPGMMQPQQ PYTGQIYQPTPAFTPTSSQSMYSSSFEDEPPLLEELGINFDHIWQKTLTVLHPLKASDGS IMNETDLAGPMVFCLAFGATLLLTGKIQFGYVYGISAIGCLGMYCLLNLMSMTGVSFGCV ASVLGYCLLPMIILSSFGVIFSLQGIMGIILTAAIIGWCSLSASKIFISALAMDGQQLLV AYPCALLYGVFALISVF
Uniprot No.

Target Background

Function

Plays a role in transport between the endoplasmic reticulum and Golgi apparatus.

Database Links
Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is YIPF5 and what is its role in Danio rerio?

YIPF5 (Yip1 domain family member 5) is a multi-span transmembrane protein primarily localized in the Golgi apparatus. In zebrafish (Danio rerio), it plays a role in membrane trafficking pathways and is also known as SMAP-5, zgc:56513, and zgc:77939 . The protein contains approximately 257 amino acids and has multiple hydrophobic segments with scattered hydrophilic residues on the C-terminal side .

Structural analysis reveals that YIPF5, like other YIPF family proteins, likely has five transmembrane helices with an N-terminal cytoplasmic region and a short C-terminal region exposed to the lumen of the Golgi apparatus . The conservation of the transmembrane region is a defining characteristic of the Yip1 domain, while the N- and C-terminal regions are less conserved.

How does YIPF5 relate to other Yip1 domain family members?

YIPF5 belongs to the Yip1 domain family (YIPF) of proteins that have been identified across virtually all eukaryotes, suggesting essential conserved functions . The family originated with Yip1p and Yif1p in Saccharomyces cerevisiae, which have paralogs Yip4p and Yip5p, respectively.

What expression systems are suitable for producing recombinant Danio rerio YIPF5?

The most common expression system for producing recombinant Danio rerio YIPF5 is E. coli, although alternative systems include yeast, baculovirus, and mammalian cells . When expressing in E. coli, the full-length protein (amino acids 1-257) can be fused with an N-terminal His tag to facilitate purification .

For successful expression in E. coli, consider these methodological approaches:

  • Codon optimization: Since rare codons in E. coli can slow protein production, optimizing the codon usage for E. coli is recommended .

  • Temperature and induction conditions: Expression at lower temperatures (16-25°C) after induction may help prevent inclusion body formation.

  • Fusion tags: Beyond His tags, other fusion partners like GST, MBP, or SUMO can increase solubility.

  • Chaperone co-expression: Co-expressing molecular chaperones can enhance proper folding of the recombinant protein .

What are the critical factors affecting expression efficiency of recombinant YIPF5?

Several factors significantly influence the successful expression of recombinant YIPF5:

  • mRNA accessibility of translation initiation sites: Research has demonstrated that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across Boltzmann's ensemble, is a critical determinant of expression success. This factor outperforms alternative features like minimum free energy (MFE) or codon adaptation index (CAI) .

  • Synonymous codon substitutions: Even minimal changes in the first nine codons through synonymous substitutions can significantly impact expression levels by altering mRNA accessibility .

  • Expression host compatibility: Different hosts have varying capacities to express membrane proteins like YIPF5. The table below compares expression systems:

Expression SystemAdvantagesChallenges for YIPF5
E. coliFast growth, high yield, economicalProper folding of transmembrane domains
YeastPost-translational modifications, membrane protein capabilityLonger production time
BaculovirusBetter folding for complex proteinsMore expensive, technically demanding
MammalianNative-like folding and modificationsLowest yield, highest cost

How can the transmembrane topology of YIPF5 be experimentally verified?

Verifying the predicted five-transmembrane topology of YIPF5 requires multiple complementary approaches:

  • Protease protection assays: By selectively permeabilizing either the plasma membrane or the Golgi membrane, followed by protease treatment, the orientation of specific domains can be determined based on their accessibility to proteolysis.

  • Site-directed mutagenesis with epitope tagging: Insert epitope tags (e.g., FLAG, HA, or Myc) at predicted loops and termini, then detect their accessibility using membrane-permeable or impermeable reagents.

  • Glycosylation site insertion: Engineer N-glycosylation sites at predicted luminal domains. Glycosylation will only occur if the domain is in the lumen.

  • Fluorescence techniques: Methods like FRET (Förster Resonance Energy Transfer) can provide information about spatial relationships between domains.

Based on previous analysis, YIPF5 proteins are predicted to have an odd number of transmembrane segments, most likely five, with the N-terminal region exposed to the cytoplasm and the C-terminal region in the Golgi lumen .

What functional assays can be used to study YIPF5 activity in zebrafish?

To investigate YIPF5 function in zebrafish, consider these methodological approaches:

  • Morpholino knockdown experiments: Design antisense morpholinos targeting YIPF5 mRNA to observe loss-of-function phenotypes during development.

  • CRISPR/Cas9 gene editing: Generate stable knockout or knock-in zebrafish lines to study long-term effects of YIPF5 disruption or modification.

  • RNA expression analysis: Use qPCR to quantify expression levels in different tissues and developmental stages. The method below has been successfully used for other zebrafish genes :

    • Extract RNA using a system like ReliaPrep RNA Miniprep

    • Treat with DNase I

    • Synthesize cDNA using a kit like iScript cDNA Synthesis kit

    • Perform qPCR using primers specific to YIPF5

    • Normalize with reference genes like ef1α, β-actin, and gapdh

  • In situ hybridization: To visualize spatial expression patterns in tissues, following protocols similar to those used for other zebrafish genes .

  • Subcellular localization: Use GFP fusion proteins or immunohistochemistry to determine precise localization within cells.

How does Danio rerio YIPF5 compare structurally and functionally with mammalian orthologs?

Comparing Danio rerio YIPF5 with mammalian orthologs reveals important evolutionary insights:

  • Sequence conservation: Alignment studies show moderate sequence identity between zebrafish YIPF5 and human YIPF5. The most conserved region is the transmembrane domain (Yip1 domain), while N- and C-terminal regions show greater divergence .

  • Expression patterns: Both zebrafish and mammalian YIPF5 are broadly expressed with enrichment in specific tissues. In zebrafish, YIPF5 shows similar tissue distribution patterns to mammalian orthologs, suggesting conserved functions .

  • Cellular localization: Both zebrafish and mammalian YIPF5 primarily localize to the Golgi apparatus, with some presence in the ER-Golgi intermediate compartment (ERGIC).

  • Functional conservation: The role in membrane trafficking and vesicular transport appears to be conserved across species, though zebrafish-specific functions may exist that haven't been fully characterized.

What can paralog analysis tell us about YIPF5 evolution in zebrafish?

Zebrafish often have multiple paralogs of single mammalian genes due to a teleost-specific genome duplication event. Analysis of YIPF family gene duplications provides insights into functional evolution:

  • Gene duplication patterns: Similar to how yeast Yip1p and Yif1p have paralogs (Yip4p and Yip5p), zebrafish may have additional YIPF5 paralogs with divergent functions .

  • Expression divergence: When paralogs exist, they often show differential expression patterns. For example, in the case of inpp5ka and inpp5kb (another duplicated gene pair in zebrafish), while both follow similar developmental expression trends, inpp5ka is much more abundantly expressed in tissues than inpp5kb .

  • Functional divergence: Paralog analysis can reveal subfunctionalization or neofunctionalization. For instance, in the inpp5k paralogs, inpp5kb has lost its catalytic activity against its preferred substrate, PtdIns(4,5)P2, demonstrating functional divergence after duplication .

How can recombinant YIPF5 be used to identify interaction partners in zebrafish?

To identify YIPF5 interaction partners in zebrafish, several complementary approaches can be employed:

  • Pull-down assays with recombinant YIPF5: Use purified His-tagged YIPF5 as bait to capture interacting proteins from zebrafish tissue lysates. The bound proteins can be identified by mass spectrometry.

  • Yeast two-hybrid screening: Generate a zebrafish cDNA library and screen for interactions with YIPF5 as bait.

  • Co-immunoprecipitation (Co-IP): Use antibodies against YIPF5 to precipitate the protein along with its binding partners from zebrafish tissues or cells.

  • Proximity labeling: Techniques like BioID or APEX2 fusion to YIPF5 can be used to biotinylate proximal proteins in living cells, which can then be purified and identified.

  • Cross-linking mass spectrometry: This approach can identify interacting proteins and provide information about the interaction interface.

Based on studies in other organisms, potential interacting partners to investigate include Rab GTPases, COPI and COPII coats, and components of vesicle tethering complexes like COG, TRAPP, and GARP .

What is the impact of post-translational modifications on YIPF5 function, and how can they be studied?

Post-translational modifications (PTMs) can significantly affect YIPF5 function, and multiple methods can be employed to study them:

  • Mass spectrometry-based approaches: Use targeted or shotgun proteomics to identify PTMs on recombinant or endogenous YIPF5.

  • Site-directed mutagenesis: Mutate potential modification sites and observe changes in localization, function, or interaction partners.

  • Phosphorylation-specific antibodies: Generate or obtain antibodies that recognize specific phosphorylated residues on YIPF5.

  • In vitro modification assays: Use purified recombinant YIPF5 and specific modification enzymes to characterize potential modifications.

Understanding PTMs is crucial as they likely regulate YIPF5's membrane association, trafficking, or interaction with binding partners in a temporal or spatial manner.

What are the main challenges in producing soluble, functional recombinant YIPF5?

As a multi-span transmembrane protein, YIPF5 presents several production challenges:

  • Membrane protein solubility: The hydrophobic transmembrane domains tend to cause aggregation and inclusion body formation. Solutions include:

    • Expression at lower temperatures (16-25°C)

    • Use of detergents during purification

    • Addition of solubility-enhancing tags like SUMO or MBP

    • Co-expression with chaperones

  • Proper folding: Ensuring correct folding of transmembrane domains in heterologous systems is difficult. Approaches include:

    • Using eukaryotic expression systems for more complex proteins

    • Including appropriate lipids in purification buffers

    • Exploring cell-free expression systems with added microsomes

  • Expression toxicity: Overexpression of membrane proteins can be toxic to host cells. Strategies include:

    • Using tightly controlled inducible promoters

    • Testing different expression strains

    • Optimizing induction conditions

How can the functionality of purified recombinant YIPF5 be verified?

Verifying the functionality of purified recombinant YIPF5 requires multiple approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Size-exclusion chromatography to confirm monodispersity

    • Native PAGE to assess oligomeric state

  • Binding assays:

    • Surface plasmon resonance (SPR) with known or predicted binding partners

    • Pull-down assays with potential interactors

    • Liposome binding assays to verify membrane association

  • Activity assays:

    • In vitro vesicle budding assays

    • Reconstitution into liposomes to study membrane integration

    • Complementation assays in YIPF5-deficient cells

  • Localization studies in model systems:

    • Introduce fluorescently tagged recombinant YIPF5 into zebrafish cells

    • Verify proper Golgi localization using confocal microscopy

How can zebrafish YIPF5 be used as a model to study human YIPF5-related disorders?

Zebrafish YIPF5 can serve as a valuable model for studying human YIPF5-related conditions through several approaches:

  • Generation of disease-specific mutations: Create zebrafish lines with mutations corresponding to human disease variants using CRISPR/Cas9 gene editing.

  • Phenotypic analysis: Characterize developmental, morphological, and functional consequences of YIPF5 disruption in zebrafish, which could reveal relevant disease mechanisms.

  • High-throughput screening: Utilize zebrafish embryos for screening compounds that might rescue YIPF5-related phenotypes, as demonstrated in other zebrafish disease models .

  • Tissue-specific analysis: Investigate tissue-specific effects of YIPF5 disruption, particularly in tissues relevant to human disease.

The zebrafish model offers several advantages for this research, including optical transparency of embryos, rapid development, and ease of genetic manipulation .

What novel imaging techniques can be applied to study YIPF5 trafficking dynamics in live zebrafish cells?

Advanced imaging techniques for studying YIPF5 trafficking in live zebrafish cells include:

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED overcome the diffraction limit to visualize YIPF5 localization with nanometer precision.

  • Live-cell imaging with photoactivatable fluorescent proteins: Use photoactivatable or photoconvertible fluorescent protein fusions to track YIPF5 movement in real-time.

  • Fluorescence recovery after photobleaching (FRAP): Measure YIPF5 mobility within membranes by photobleaching a region and monitoring fluorescence recovery.

  • Fluorescence correlation spectroscopy (FCS): Analyze YIPF5 diffusion and interaction dynamics in membranes at single-molecule resolution.

  • Optogenetic approaches: Use light-controlled protein interactions to manipulate YIPF5 function with spatiotemporal precision in specific cells or tissues.

  • Light sheet microscopy: Enables long-term imaging of developing zebrafish with minimal phototoxicity, useful for tracking YIPF5 dynamics during embryonic development.

These techniques, combined with the genetic tractability and optical transparency of zebrafish, provide powerful tools for understanding the dynamic behavior of YIPF5 in vivo.

What bioinformatic approaches can help predict the impact of mutations in zebrafish YIPF5?

Several bioinformatic approaches can help predict the functional consequences of YIPF5 mutations:

  • Evolutionary conservation analysis: Identify highly conserved residues across species using multiple sequence alignments, which are likely functionally important.

  • Structural modeling: Generate 3D models using tools like AlphaFold2 or homology modeling to predict how mutations might affect protein structure.

  • Molecular dynamics simulations: Simulate the behavior of wild-type and mutant proteins to understand potential structural and dynamic changes.

  • Machine learning-based prediction tools: Use algorithms trained on known mutation effects to predict the impact of novel variants.

  • Network analysis: Examine how mutations might affect YIPF5's interactions with other proteins in membrane trafficking pathways.

For membrane proteins like YIPF5, special attention should be paid to mutations in transmembrane regions or at interfaces with the membrane or other proteins.

How can multi-omics data be integrated to understand YIPF5 function in zebrafish development?

Integrating multi-omics data provides a comprehensive understanding of YIPF5 function:

  • Transcriptomics: RNA-seq to profile gene expression changes in YIPF5-modified zebrafish, identifying pathways affected by YIPF5 perturbation.

  • Proteomics: Mass spectrometry to identify and quantify proteins affected by YIPF5 manipulation, including potential interacting partners.

  • Interactomics: Techniques like BioID or AP-MS to map the YIPF5 interaction network in different tissues or developmental stages.

  • Phosphoproteomics: Identify signaling pathways affected by YIPF5 through changes in protein phosphorylation patterns.

  • Glycomics: Assess if YIPF5 perturbation affects glycosylation patterns, given its location in the Golgi apparatus.

  • Data integration: Use computational frameworks to integrate these datasets, identifying convergent evidence for YIPF5 functions and placing it within cellular pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.