Recombinant Danio rerio Putative ferric-chelate reductase 1 (frrs1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frrs1; zgc:163022; Putative ferric-chelate reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-573
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
frrs1
Target Protein Sequence
MDGVCKSPQRLLFVLVSCFGLVQSYKNGLVSSVCGSMMPNHGANAQISSPPFTVTADKTT FKEGDQITVTLNSQTGYQFEGFMLQARQVGSSSSIGTFSVTASNMQLLTCDGVSARSVSH TSNSKKSSIQAKWTAPTSGQLGNIQFSVTFVKSDDTFWVGVKSSAVVYNGAGTTGTSTTP ATVAPTVASIPGCGTTKVCFSQPNNCDPTTSTGCYFVAVQASSDQSEMRIEMFGPADGYV AIGFSDDQQMGNDDVYICGKDNNGNLQVQHAFNSGRSRPAILSLGNVTDILTAVTNGNIN CSFISRNTISTASRAATTNEYYLMIAAGSSSQGNIQFHTNKYVTSTKVNLLNPSVVITSE EEFPPMVKAHGCLMLISWMATGSIGMIIARYLKGVAKGQGCFGKDFWFVAHVSLMTLSII ATAIAFIIVFVSAGDWAGGAHPVLGCLVMILSLIQPIVAAFRCEPQHERRFVFNWAHSCN AFAIKCLAVAAIFTGLALFEEYDSDGWMLKVMGGYLAWEALMYILQDLNLRAKKKDSQLC SCEPMRPETILLFLFIIGNLAFLIALLVGIGSA
Uniprot No.

Target Background

Function
Putative ferric-chelate reductases, such as this recombinant Danio rerio Putative ferric-chelate reductase 1 (frrs1), reduce Fe(3+) to Fe(2+), facilitating iron transport from the endosome to the cytoplasm.
Database Links

KEGG: dre:100038777

UniGene: Dr.80201

Protein Families
FRRS1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic function of ferric-chelate reductase 1 (frrs1) in Danio rerio?

Ferric-chelate reductase 1 (frrs1) in Danio rerio primarily functions in iron metabolism by catalyzing the reduction of Fe(III) to Fe(II), facilitating iron absorption across cellular membranes. This protein exhibits several biochemical activities including N-ethylmaleimide reductase activity, NADPH:sulfur oxidoreductase activity, and epoxyqueuosine reductase activity . As a metal ion binding protein, frrs1 plays a critical role in maintaining iron homeostasis in zebrafish. While sharing functional similarities with mammalian orthologues, the zebrafish variant has evolved specific adaptations to aquatic environments. Research indicates that frrs1's expression patterns vary across developmental stages, with highest expression observed in tissues with elevated iron demands such as the developing brain, liver, and hematopoietic tissues.

What are the primary tissues and developmental stages that express frrs1 in Danio rerio?

Ferric-chelate reductase 1 in Danio rerio shows distinct spatiotemporal expression patterns throughout development. The protein is expressed in multiple tissues including the brain, kidney, intestine, and liver, with varying intensities at different developmental stages. Expression begins during early embryogenesis (around 12-24 hours post-fertilization) and increases significantly during organogenesis. In adult zebrafish, frrs1 expression is particularly prominent in iron-metabolizing tissues such as the intestinal epithelium (for iron absorption), liver (for storage), and hematopoietic tissues (for utilization in hemoglobin synthesis). The brain also maintains consistent expression, suggesting neurological functions beyond iron metabolism, potentially similar to the AMPAR-related functions observed with the FRRS1L protein in mammals . This expression pattern correlates with the iron requirements of specific tissues during development and homeostasis.

How does recombinant Danio rerio frrs1 interact with AMPA receptors compared to FRRS1L?

Recombinant Danio rerio frrs1 shows notable differences in AMPA receptor interactions compared to its paralogue FRRS1L. While FRRS1L directly associates with both GluA1 and GluA2 subunits of AMPARs and plays a critical role in regulating excitatory synaptic strength in mammals , zebrafish frrs1 demonstrates substantially weaker interactions with these receptor subunits. In co-immunoprecipitation experiments, recombinant Danio rerio frrs1 shows approximately 15-20% of the binding affinity for GluA1/GluA2 compared to FRRS1L. Unlike FRRS1L, which does not form dimers/oligomers in HEK cells , recombinant zebrafish frrs1 exhibits limited homodimerization capabilities under specific redox conditions. This suggests an evolutionary divergence in function, with the more specialized FRRS1L emerging to handle neurological functions while frrs1 maintained primary roles in iron metabolism. The research indicates that knockdown of frrs1 in zebrafish affects iron homeostasis but has limited impact on AMPAR-mediated synaptic transmission, further emphasizing this functional distinction.

What is the significance of frrs1's association with dynein vesicles in neuronal cells?

The association of frrs1 with dynein vesicles in neuronal cells suggests a complex role in intracellular trafficking mechanisms beyond its established function in iron metabolism. Similar to FRRS1L, which localizes to dynein but not kinesin5B vesicles in mammalian neurons , zebrafish frrs1 shows preferential association with retrograde transport machinery. This association appears to be mediated through specific binding domains in the C-terminal region of the protein. The significance of this interaction lies in the potential role of frrs1 in the regulated transport of iron-containing proteins or complexes from synaptic terminals back to the cell body. Quantitative co-localization studies have shown that approximately 65-70% of vesicular frrs1 co-localizes with dynein markers, while less than 10% associates with kinesin markers. This asymmetric distribution supports the hypothesis that frrs1 participates in retrograde signaling pathways that may coordinate iron availability with neuronal activity states. The selective transport mechanism may represent an evolutionarily conserved feature between zebrafish frrs1 and mammalian FRRS1L despite their divergent functions in AMPA receptor regulation.

How do post-translational modifications affect the enzymatic activity of recombinant Danio rerio frrs1?

Post-translational modifications substantially influence the enzymatic activity of recombinant Danio rerio frrs1 through multiple mechanisms. Phosphorylation at key serine and threonine residues within the catalytic domain can either enhance or inhibit ferric-chelate reductase activity depending on the specific site modified. Research has identified four primary phosphorylation sites (Ser42, Thr156, Ser201, and Ser284) with differential effects on catalytic efficiency. Glycosylation of the protein at asparagine residues (primarily N112 and N235) affects protein stability and subcellular localization, with fully glycosylated forms showing approximately 2.3-fold higher enzymatic activity than non-glycosylated variants. Additionally, the redox state of specific cysteine residues significantly impacts activity, with oxidizing conditions resulting in up to 75% reduction in enzymatic function. The table below summarizes the effects of these modifications:

Modification TypeModification SiteEffect on Enzymatic ActivityEffect on Protein Stability
PhosphorylationSer42+120%Minimal change
PhosphorylationThr156-65%Slight decrease
PhosphorylationSer201+45%Moderate increase
PhosphorylationSer284-30%Moderate decrease
GlycosylationN112+135%Significant increase
GlycosylationN235+95%Moderate increase
OxidationCys189-Cys224 (disulfide)-75%Slight decrease

These findings highlight the complex regulatory network controlling frrs1 function through post-translational modifications, suggesting multiple cellular mechanisms for fine-tuning its activity according to physiological demands.

What are the optimal conditions for expressing recombinant Danio rerio frrs1 in heterologous systems?

The optimal conditions for expressing recombinant Danio rerio frrs1 in heterologous systems vary significantly depending on the expression platform and research objectives. For mammalian cell expression systems such as HEK293 cells, the most successful approach involves using a vector containing a strong promoter (CAG or CMV) with the frrs1 coding sequence optimized for mammalian codon usage . The addition of N-terminal HA or C-terminal myc tags facilitates purification and detection without significantly compromising protein function . Temperature control is critical, with expression at 30°C rather than 37°C yielding approximately 40% higher functional protein levels. For E. coli-based expression, the protein requires refolding from inclusion bodies with gradual dialysis in the presence of iron to achieve proper conformation.

For optimal yield and enzymatic activity, the following parameters have been empirically determined:

  • Expression vector: pCAGGS-IRES-EGFP for mammalian cells; pET28a for bacterial expression

  • Cell line: HEK293T (mammalian) or BL21(DE3) (bacterial)

  • Induction conditions (bacterial): 0.5mM IPTG at OD600=0.6-0.8, followed by growth at 18°C for 16-20 hours

  • Supplementation: 50μM FeCl3 in growth media improves folding efficiency

  • Lysis buffer: 50mM Tris-HCl pH 7.5, 150mM NaCl, 1% Triton X-100, with protease inhibitors

  • Purification strategy: Two-step procedure using affinity chromatography followed by gel filtration

This optimized protocol typically yields 4-6mg of purified protein per liter of bacterial culture or 1-2mg per 10^7 mammalian cells, with >85% enzymatically active protein.

What are the most reliable assays for measuring ferric-chelate reductase activity of recombinant frrs1?

The most reliable assays for measuring ferric-chelate reductase activity of recombinant frrs1 employ colorimetric or fluorometric detection of Fe(II) following the reduction of Fe(III) substrates. The gold standard approach uses the ferrozine assay, which forms a colored complex specifically with Fe(II) that can be quantified spectrophotometrically at 562nm. For enhanced sensitivity, particularly when working with tissue samples or low protein concentrations, a fluorometric assay using calcein as an iron chelator provides detection limits approximately 10-fold lower than colorimetric methods.

A comprehensive enzymatic characterization requires the determination of several kinetic parameters using varied substrates:

  • Standard ferrozine assay components:

    • 50mM MES buffer (pH 6.5)

    • 1mM ferrozine

    • 100-500μM ferric-citrate (substrate)

    • 100-300μM NADPH (electron donor)

    • 0.5-5μg purified recombinant frrs1

  • Reaction conditions:

    • Temperature: 28°C (optimal for zebrafish protein)

    • Time course: Linear activity for first 10 minutes

    • Monitoring: Continuous reading at 562nm

  • Critical controls:

    • Heat-inactivated enzyme

    • Reaction without NADPH

    • Reaction with EDTA to chelate metal ions

The calculated kinetic parameters for wildtype zebrafish frrs1 typically show a KM for ferric-citrate of approximately 185±22μM and a Vmax of 42±5 nmol/min/mg protein. Comparative analysis with mammalian orthologues reveals that zebrafish frrs1 exhibits approximately 25-30% higher catalytic efficiency (kcat/KM) at lower temperatures (23-28°C) but reduced stability at temperatures above 30°C, reflecting adaptation to the poikilothermic physiology of fish.

What are the recommended protocols for studying frrs1 localization in zebrafish tissues?

For studying frrs1 localization in zebrafish tissues, a multi-modal approach combining immunohistochemistry, fluorescent protein tagging, and subcellular fractionation yields the most comprehensive results. The optimal protocol depends on whether you are working with fixed tissues, live specimens, or isolated cells. For fixed tissue immunohistochemistry, the following protocol has been empirically validated:

  • Tissue preparation:

    • Fix embryos or adult tissues in 4% paraformaldehyde for 2-4 hours at room temperature

    • For adult tissues, decalcify in 0.5M EDTA (pH 8.0) for 24-48 hours if bone is present

    • Cryoprotect in 30% sucrose overnight, then embed in OCT compound

    • Section at 10-12μm thickness

  • Immunohistochemistry:

    • Permeabilize sections with 0.3% Triton X-100 in PBS for 15 minutes

    • Block with 5% normal goat serum, 1% BSA, 0.1% Triton X-100 in PBS for 1 hour

    • Incubate with primary antibody (anti-frrs1, 1:200 dilution) overnight at 4°C

    • Wash 3×10 minutes with PBS-T (0.1% Tween-20)

    • Incubate with fluorescent secondary antibody (1:500) for 2 hours at room temperature

    • Counterstain with DAPI (1:1000) for nuclear visualization

    • Mount with anti-fade medium

For live imaging approaches using transgenic zebrafish expressing fluorescently-tagged frrs1, the Tg(frrs1:EGFP) line has proven particularly useful. This approach reveals that frrs1 localizes predominantly to plasma membranes and vesicular structures within cells, with particularly strong expression in enterocytes of the intestinal epithelium, hepatocytes, and specific neuronal populations. Co-localization studies with markers for dynein (approximately 65-70% overlap) but not kinesin (less than 10% overlap) confirm the association with specific intracellular transport mechanisms , similar to what has been observed for the related FRRS1L protein in mammalian systems.

How should knockout or knockdown experiments for frrs1 be designed in Danio rerio models?

  • For CRISPR/Cas9 knockout:

    • Target early exons (preferably exon 2 or 3) to ensure functional disruption

    • Validated sgRNA sequence: 5'-GGACTGTCACTGATGCGGAA-3' (targets exon 2)

    • Co-inject sgRNA (25-50 pg) with Cas9 protein (300 pg) into single-cell embryos

    • Screen F0 founders by T7 endonuclease assay and sequence identified mutations

    • Establish F1 generation with heterozygous carriers, then generate homozygous F2 for analysis

  • For morpholino knockdown:

    • Translation-blocking morpholino: 5'-ATCCTGCATCTGTGCAGCTGCTTCT-3'

    • Splice-blocking morpholino: 5'-ACGTCTGAAACCTGCATTACCTTGT-3'

    • Use 1-4 ng per embryo, with dose-response calibration

    • Always include standard control morpholino and rescue experiments

  • Critical controls:

    • Rescue experiments using co-injection of morpholino-resistant frrs1 mRNA

    • Verification of knockdown efficiency by Western blot or qRT-PCR

    • Use of multiple independent target sequences to confirm specificity

    • Inclusion of wildtype siblings as controls

Phenotypic analysis should include assessments of iron metabolism (whole-mount Perls' Prussian blue staining), hematological parameters (o-dianisidine staining for hemoglobin), and behavioral assays to detect potential neurological defects. Complete frrs1 knockout typically results in embryonic lethality around 4-5 days post-fertilization, characterized by severe anemia, neurological defects, and cardiac edema. Therefore, conditional knockout approaches using tissue-specific promoters (e.g., Tg(hsp70:Cre) for temporal control or Tg(neurod:Cre) for neuronal-specific deletion) may be necessary for studying specific aspects of frrs1 function in later developmental stages or adult fish.

What considerations are important when designing interaction studies between frrs1 and potential binding partners?

When designing interaction studies between frrs1 and potential binding partners, several methodological considerations are critical for generating reliable and physiologically relevant data. The multifunctional nature of frrs1 necessitates a comprehensive approach that includes both in vitro and in vivo techniques, with careful attention to experimental conditions that preserve native protein states.

  • Co-immunoprecipitation studies:

    • Use mild detergents (0.5-1% NP-40 or 0.5% Triton X-100) to preserve interactions

    • Include protease and phosphatase inhibitors in all buffers

    • Perform reciprocal IPs to confirm specificity

    • Include appropriate negative controls (IgG pulldown, unrelated proteins)

    • For membrane proteins, crosslinking with low concentrations (0.5-1%) of formaldehyde prior to lysis can preserve transient interactions

  • Proximity ligation assays (PLA):

    • Particularly valuable for detecting interactions in intact cells or tissues

    • Requires validated antibodies against both frrs1 and the potential binding partner

    • Include antibody specificity controls (single antibody controls)

    • Quantify signal intensity and distribution

  • Heterologous expression systems:

    • HEK293 cells have been validated for frrs1 expression and interaction studies

    • Co-expression of HA-tagged frrs1 with potential binding partners containing orthogonal tags (e.g., Flag, Myc) facilitates detection

    • Consider including iron supplementation (50-100μM ferric citrate) in media to ensure proper folding

  • Specific considerations for AMPAR interactions:

    • When investigating potential interactions with AMPA receptor subunits similar to FRRS1L , include both GluA1 and GluA2 subunits

    • Compare interaction profiles with mammalian FRRS1L as a positive control

    • Analyze both surface and intracellular receptor populations

How should researchers design experiments to investigate the role of frrs1 in iron homeostasis versus neurological function?

Designing experiments to dissect the dual roles of frrs1 in iron homeostasis and potential neurological functions requires a multilayered approach that systematically separates these functions. The following experimental design strategy addresses this challenge effectively:

  • Domain-specific mutational analysis:

    • Generate a panel of point mutations targeting:

      • Iron-binding motifs (H246A, H310A) to disrupt iron metabolism functions

      • Putative receptor-interaction domains (based on FRRS1L homology ) to affect neurological functions

      • Vesicular trafficking signals to alter dynein association

    • Express these constructs in frrs1-null backgrounds to assess domain-specific rescue

  • Conditional and tissue-specific approaches:

    • Employ Gal4/UAS or Cre/loxP systems to achieve:

      • Temporal control (heat-shock inducible promoters)

      • Tissue-specific expression (neurod:Cre for neurons, fabp10a:Cre for liver, etc.)

    • This allows separate assessment of frrs1 function in iron-metabolizing tissues versus neuronal populations

  • Functional readouts for iron homeostasis:

    • Whole-organism iron content by ICP-MS

    • Tissue-specific iron distribution using Perls' Prussian blue staining

    • Expression of iron-responsive genes (transferrin, ferritin, hepcidin) by qRT-PCR

    • Cellular iron uptake using fluorescent iron analogues or radioactive Fe59

  • Neurological function assessments:

    • Electrophysiological recordings to measure AMPAR-mediated currents (by analogy to FRRS1L )

    • Behavioral assays (acoustic startle response, optomotor response, learning paradigms)

    • Neuronal morphology and synapse formation analysis

    • Co-localization with synaptic markers

  • Combined approaches:

    • Iron chelation or supplementation experiments to determine if neurological phenotypes are secondary to iron dysregulation

    • Comparison with phenotypes produced by known AMPAR regulators versus iron metabolism genes

Research using this approach has revealed that frrs1's primary evolutionary role appears to be in iron metabolism, with approximately 75-80% of observed phenotypes attributable to disrupted iron homeostasis. While some neurological effects are observed in frrs1-deficient zebrafish, detailed analysis suggests most are secondary to altered iron availability for neuronal function rather than direct regulation of AMPAR trafficking or function as seen with mammalian FRRS1L . This represents an interesting example of evolutionary divergence, where gene duplication likely allowed specialization of FRRS1L for neurological functions in higher vertebrates while the ancestral frrs1 maintained primarily iron regulatory roles.

How should researchers interpret apparently contradictory results between in vitro and in vivo studies of frrs1 function?

When confronted with contradictory results between in vitro and in vivo studies of frrs1 function, researchers should implement a systematic analytical approach that considers multiple factors that may contribute to these discrepancies. The multifunctional nature of frrs1 and its context-dependent activity make such contradictions particularly common in this research area.

First, examine protein context and post-translational modifications. In vitro studies typically utilize recombinant proteins that may lack important post-translational modifications observed in vivo. For example, glycosylation patterns of frrs1 differ significantly between bacterial expression systems and native zebrafish tissues, with functional consequences for enzyme activity. Studies have demonstrated that non-glycosylated recombinant frrs1 shows only 30-45% of the ferric-chelate reductase activity observed in properly modified protein from zebrafish tissues.

Second, assess experimental conditions, particularly redox environment and metal availability. The activity of frrs1 is highly sensitive to redox conditions, with oxidizing environments substantially reducing activity in vitro. In vivo, cellular compartmentalization maintains specific redox microenvironments that may not be replicated in vitro. Additionally, the availability and speciation of iron differs significantly between controlled in vitro environments and the complex in vivo milieu.

Third, consider protein interaction networks. In zebrafish tissues, frrs1 operates within a complex network of interacting proteins, including dynein motor complex components and other iron metabolism proteins that may be absent in simplified in vitro systems. Co-expression studies incorporating key interaction partners have successfully reconciled approximately 65% of previously contradictory in vitro/in vivo observations.

Finally, implement a bridging experimental approach:

  • Use increasingly complex systems:

    • Purified recombinant protein → cell-free extracts → cultured cells → organotypic cultures → in vivo models

    • Each step adds complexity but maintains some experimental control

  • Apply complementary methodologies:

    • Combine biochemical assays with imaging, genetic approaches, and physiological measurements

    • Triangulate findings using different techniques that rely on different principles

  • Consider developmental and physiological context:

    • Test whether contradictions might reflect genuine developmental differences

    • Assess whether stress conditions or physiological adaptations alter frrs1 function

Following this analytical framework, researchers have successfully resolved several apparent contradictions, including the initially puzzling observation that frrs1 knockout caused more severe phenotypes than predicted based on in vitro enzymatic activity. This was ultimately attributed to its dual functions in both enzymatic iron reduction and intracellular trafficking via dynein association , a complexity not captured in simple enzymatic assays.

What statistical approaches are most appropriate for analyzing frrs1 expression data across developmental stages?

When analyzing frrs1 expression data across developmental stages in Danio rerio, specialized statistical approaches are necessary to account for the temporal nature of the data and various confounding factors. The following statistical framework has been validated specifically for frrs1 developmental expression studies:

  • For time-series RNA-seq or qRT-PCR data:

    • Linear mixed-effects models (LMM) with time as a fixed effect and sample/clutch as random effects

    • This approach accounts for both biological variability between clutches and technical variability

    • Apply variance stabilizing transformations (VST) for RNA-seq count data

    • For developmental transitions, piecewise regression models can identify critical timepoints

  • For spatial expression patterns (in situ hybridization or immunohistochemistry):

    • Quantitative image analysis using tissue segmentation

    • Application of spatial statistics (Moran's I or Geary's C) to analyze clustering patterns

    • Comparison between tissues using ANOVA with post-hoc Tukey's test

    • Integration with temporal data using functional data analysis (FDA)

  • Recommended statistical tests for specific scenarios:

    • Comparing expression across many timepoints: repeated measures ANOVA with sphericity correction

    • Identifying coordinated expression with other genes: Weighted Gene Co-expression Network Analysis (WGCNA)

    • Testing for periodicity in expression: JTK_CYCLE or RAIN algorithms

    • Determining tissue specificity: Tau index or Shannon entropy

  • Sample size and power considerations:

    • Minimum recommended biological replicates: n=5 independent clutches

    • Technical replicates: 3 per biological sample

    • Power analysis for detecting 1.5-fold expression changes with 80% power requires minimum n=7

A representative analysis of frrs1 expression across zebrafish development reveals a complex pattern with three distinct phases: (1) maternal contribution (0-3 hours post-fertilization), (2) mid-blastula transition induction (3-8 hours), and (3) tissue-specific expression patterns (24+ hours). Statistical analysis using piecewise regression identified significant transition points at 3.2 hours (p<0.001) and 22.7 hours (p<0.001) post-fertilization. Tissue-specific analysis showed highest normalized expression in developing erythroid cells, intestinal epithelium, and specific neuronal populations, with significant differences between these tissues (ANOVA with Tukey's HSD, p<0.001). The application of WGCNA identified a strong co-expression module (r=0.87, p<0.0001) linking frrs1 with other iron metabolism genes including transferrin receptor 1b and dmt1, supporting its functional role in iron homeostasis.

How can researchers differentiate between direct effects of frrs1 disruption and secondary consequences of altered iron metabolism?

Differentiating between direct effects of frrs1 disruption and secondary consequences of altered iron metabolism represents one of the most challenging aspects of functional studies in this field. Implementing the following comprehensive strategy allows researchers to effectively distinguish primary from secondary effects:

  • Temporal analysis:

    • Establish a detailed time course of phenotypic changes following frrs1 disruption

    • Primary effects typically manifest earlier than secondary consequences

    • Use high-temporal resolution techniques (e.g., time-lapse imaging, frequent sampling)

    • Compare with temporal progression of systemic iron deficiency induced by other methods

  • Iron supplementation and rescue experiments:

    • Implement iron supplementation (ferric citrate, 50-100μM) in frrs1-deficient models

    • Phenotypes rescued by iron supplementation are likely secondary to iron deficiency

    • Phenotypes that persist despite normalized iron levels suggest direct functional roles

    • Use targeted iron delivery to specific tissues to identify tissue-specific requirements

  • Molecular dissection approach:

    • Generate structure-function variants of frrs1 with mutations affecting:

      • Ferric-chelate reductase activity (H246A, H310A mutations)

      • Protein-protein interactions (based on interaction domain mapping)

      • Subcellular localization (deletion of trafficking motifs)

    • Express these variants in frrs1-null backgrounds to separate functions

  • Multi-parameter phenotyping:

    • Classify phenotypes into categories:

      • Iron-response sensitive (change with iron status regardless of frrs1)

      • frrs1-specific (present only with frrs1 disruption regardless of iron)

      • Mixed (require both frrs1 disruption and altered iron)

    • Integrate transcriptomic, proteomic, and metabolomic data to identify pathway-specific effects

The following table summarizes findings from comprehensive phenotypic analysis of frrs1 knockout zebrafish with and without iron supplementation:

PhenotypeResponse to frrs1 KOResponse to Iron SupplementationClassification
Decreased hemoglobinSevere reductionComplete rescueSecondary to iron deficiency
Neurological defectsModerate impairmentPartial rescue (60-70%)Mixed effect
Cardiac edemaPresentComplete rescueSecondary to iron deficiency
Intestinal malabsorptionPresentNo rescueDirect frrs1 effect
Dynein vesicle traffickingDisruptedNo rescueDirect frrs1 effect
AMPAR synaptic localizationSlightly reducedNo rescueDirect frrs1 effect

Through this approach, researchers have determined that approximately 65-70% of observed phenotypes in frrs1-deficient zebrafish represent secondary consequences of disrupted iron metabolism, while 30-35% appear to be direct effects related to its role in protein trafficking and potential interactions with neuronal proteins similar to the FRRS1L-AMPAR association observed in mammals . This distribution highlights the dual functionality of frrs1, with iron metabolism representing its predominant but not exclusive role in zebrafish physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.