Recombinant Danio rerio Reactive oxygen species modulator 1 (romo1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio ROMO1

ROMO1 is a 79-amino acid mitochondrial inner membrane protein that regulates reactive oxygen species (ROS) production and modulates oxidative stress pathways . Recombinant versions are produced in heterologous systems like E. coli, yeast, and baculovirus for studies in oxidative stress, antibacterial activity, and mitochondrial dynamics .

Key Features

PropertyDetailsSource
SpeciesDanio rerio (Zebrafish)
Expression SystemE. coli, Yeast, Baculovirus
TagHis-tag (N-terminal)
Molecular Weight~8 kDa
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; reconstitute in Tris/PBS buffer with 6% Trehalose (pH 8.0)

Functional Characteristics

  • ROS Modulation: Induces ROS production via mitochondrial electron transport chain interactions, critical for cellular proliferation and stress responses .

  • Antibacterial Activity: Disrupts bacterial membranes (e.g., S. aureus, P. aeruginosa) through membrane permeabilization .

  • Mitochondrial Dynamics: Interacts with translocases (e.g., TIM16, TIM23) to regulate protein import and inner membrane integrity .

Pathway Interactions

PathwayRole of ROMO1Reference
TGF-β SignalingModulates Smad2/3 activation and extracellular matrix remodeling
NF-κB ActivationEnhances pro-inflammatory cytokine production (e.g., IL-1β, TNF-α)
ApoptosisTriggers cytochrome C release via JNK/p38 kinase activation

In Zebrafish Models

  • COVID-19 Cytokine Storm: Recombinant Spike protein (rSpike) upregulated romo1 mRNA, correlating with oxidative stress and inflammation. Photobiomodulation (PBM) reduced romo1 expression, suggesting therapeutic potential .

  • Mitochondrial Interactions: ROMO1 partners with TIM16 (score: 0.897) and TIM23 (score: 0.832) in mitochondrial protein import .

Comparative Analysis

Recombinant FormExpression SystemApplicationsPurity
RFL29469HFE. coliSDS-PAGE, functional assays>90%
CSB-YP020063DIL1YeastStructural studies, antibody productionInquire
CSB-EP020063DIL1E. coliBiotinylation assaysInquire

Applications in Biomedical Research

  • Oxidative Stress Studies: Used to model ROS-mediated diseases (e.g., infertility, cancer) .

  • Drug Screening: Evaluates compounds targeting mitochondrial ROS pathways .

  • Antibacterial Development: Tests efficacy against multidrug-resistant bacteria .

Limitations and Future Directions

  • Species-Specific Variants: Zebrafish ROMO1 shares 86% sequence identity with humans, necessitating cross-species validation .

  • Therapeutic Challenges: Overexpression links to inflammation and apoptosis, requiring precise dosage control .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
romo1; zgc:73345; Reactive oxygen species modulator 1; ROS modulator 1; Protein MGR2 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-80
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
romo1
Target Protein Sequence
MPVSVGSYGQQAQPSCFDRVKMGFMMGFAVGMAAGAMFGTFSCLRIGMRGRELMGGVGKT MMQSGGTFGTFMAIGMGIRC
Uniprot No.

Target Background

Function
This protein exhibits antibacterial activity against various bacteria, including *Staphylococcus aureus*, *Pseudomonas aeruginosa*, and *Mycobacterium tuberculosis*. It exerts its effect by inducing bacterial membrane disruption. Additionally, it stimulates the production of reactive oxygen species (ROS), which are essential for cell proliferation. This protein may also contribute to oxidative DNA damage and replicative senescence. It is involved in the coordination of mitochondrial morphology and cell proliferation.
Database Links
Protein Families
MGR2 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.