Recombinant Danio rerio Receptor expression-enhancing protein 3 (reep3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
reep3; zgc:55529; Receptor expression-enhancing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
reep3
Target Protein Sequence
MVSWMISRSVVLVFGNLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALFTVVETVADLTIA WFPLYYEIKIAFVIWLLSPYTRGASVIYRKALHPLLSSKEREIDDYIVQAKERSYETMVN FGKQGLTIAATAAVSAAVKGQGAITEKLRSFSMHDLTQIPQDDGYSSYASNPARRAIMDQ PDGAEYYHGDDDDRSDEDSKPVFSEDEAVSHHGLRRSQSVKVTRSKLRRDARYGSLKIKG RKRPGINATTYSNMES
Uniprot No.

Target Background

Function

Function: Reep3 is a microtubule-binding protein crucial for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum away from chromosomes during mitosis, likely by clearing the endoplasmic reticulum membrane from metaphase chromosomes.

Database Links
Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of REEP3 in zebrafish development?

REEP3 (Receptor Expression-Enhancing Protein 3) serves as a pivotal enzyme crucial for endoplasmic reticulum (ER) clearance during mitosis and plays important roles in ER morphology and remodeling . In zebrafish development, REEP3 likely contributes to cellular organization and division during rapid embryonic growth phases. The protein belongs to the REEP family, which includes REEP1, REEP2, REEP3, REEP4, REEP5, and REEP6, all of which are involved in modulating endoplasmic reticulum structure and function . When studying REEP3 in zebrafish larvae, researchers should consider developmental timing, as the functional significance may vary across different developmental stages, similar to how other molecular mechanisms demonstrate stage-specific roles in the zebrafish model .

How does zebrafish REEP3 compare structurally to human REEP3?

While the search results don't provide direct structural comparison data, comparative genomic approaches suggest conservation of core functional domains between human and zebrafish REEP3. For methodological analysis, researchers should conduct sequence alignment analyses comparing Danio rerio REEP3 with human orthologs, focusing on critical functional domains involved in ER interactions. Protein modeling approaches can predict structural similarities and differences that might impact function. The protein-protein interaction network of REEP3 includes interactions with other REEP family members (REEP1, REEP2, REEP4, REEP5, REEP6) and ARL6IP5 , which likely demonstrates conservation across vertebrate species.

What expression patterns does REEP3 show in different zebrafish tissues during development?

Methodologically, researchers should employ in situ hybridization and immunohistochemistry techniques to map REEP3 expression across developmental timepoints (24-120 hpf). Based on analogous studies in zebrafish, expression pattern analysis should focus particularly on tissues with high ER content and mitotic activity. While specific zebrafish REEP3 expression data isn't provided in the search results, experimental approaches similar to those used in the zebrafish renal function studies would be appropriate for characterizing tissue-specific expression patterns.

What expression systems are most effective for producing recombinant Danio rerio REEP3?

For membrane-associated proteins like REEP3, methodology selection should consider protein folding and post-translational modifications. Effective expression systems include:

  • Bacterial systems: E. coli BL21(DE3) strains with specialized vectors containing solubility tags (MBP, SUMO) can improve yield, though may compromise authentic folding

  • Insect cell systems: Baculovirus expression in Sf9 cells better preserves protein structure

  • Mammalian cell systems: HEK293 cells provide optimal post-translational modifications

Researchers should optimize expression by testing different fusion tags, induction conditions, and purification strategies. For membrane-associated proteins like REEP3, detergent screening is essential for solubilization while maintaining native conformation.

What purification strategies are recommended for obtaining high-purity recombinant zebrafish REEP3?

A methodological approach to REEP3 purification should incorporate:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Intermediate purification: Ion exchange chromatography optimized for REEP3's theoretical isoelectric point

  • Polishing: Size exclusion chromatography to remove aggregates and achieve >95% purity

Critical purification considerations include maintaining protein stability by incorporating appropriate detergents throughout the process, and confirming identity using mass spectrometry. Western blotting using anti-REEP3 antibodies validates purification success. When designing purification protocols, researchers should consider that REEP3 interacts with at least 11 other proteins in its network , which may complicate purification if co-expressed in the same system.

What analytical methods should be used to verify the structural integrity of purified recombinant zebrafish REEP3?

Methodological verification of recombinant REEP3 should include complementary analytical approaches:

  • Circular Dichroism (CD) spectroscopy: Evaluates secondary structure content

  • Differential Scanning Fluorimetry: Determines thermal stability and buffer optimization

  • Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS): Confirms molecular weight and oligomeric state

  • Limited proteolysis: Identifies stable domains and flexible regions

Functional validation can utilize binding assays with known interaction partners from the established REEP3 protein network . Researchers should compare results to previously published structural data on other REEP family members to assess expected structural elements.

How can researchers effectively use recombinant zebrafish REEP3 in studies of endoplasmic reticulum dynamics?

Methodologically, recombinant REEP3 can be employed as a tool to study ER dynamics through multiple experimental approaches:

  • Fluorescently-tagged constructs: Generation of GFP/RFP-REEP3 fusion proteins for live imaging of ER dynamics in zebrafish cells

  • Dominant-negative constructs: Engineering mutated recombinant REEP3 to disrupt native REEP3 function

  • In vitro reconstitution assays: Using purified REEP3 with artificial membranes to study direct effects on membrane curvature and modeling

Analytical approaches should include advanced imaging techniques like super-resolution microscopy to visualize REEP3-dependent ER remodeling events. Researchers should apply established zebrafish imaging methodologies similar to those used in other zebrafish studies that employed "fluorescent-based laser scanning microscopy" for in vivo visualization.

What experimental design considerations are important when using recombinant REEP3 in zebrafish mitotic studies?

For studying REEP3's role in mitosis, methodological approaches should include:

  • Microinjection timing: Optimize delivery of recombinant REEP3 at specific developmental stages (1-4 cell) to target early mitotic events

  • Dosage determination: Establish dose-response curves to identify physiologically relevant concentrations

  • Co-injection with markers: Combine REEP3 with nuclear or cell cycle markers for correlative imaging

Experimental designs should incorporate appropriate controls including heat-inactivated REEP3 and irrelevant proteins of similar size. Time-lapse imaging approaches similar to those employed in zebrafish larva models for other studies would allow visualization of mitotic dynamics in the presence of exogenous REEP3.

How can recombinant zebrafish REEP3 be used to identify novel interaction partners in zebrafish cells?

Methodological approaches for interaction partner identification include:

  • Affinity purification-mass spectrometry (AP-MS): Using recombinant REEP3 as bait to pull down interaction partners from zebrafish cell lysates

  • Proximity labeling techniques: BioID or APEX2 fusions to REEP3 to identify proximal proteins in living cells

  • Yeast two-hybrid screening: Using REEP3 domains as bait against zebrafish cDNA libraries

Data analysis should include stringent filtering to eliminate common contaminants and quantitative comparison with control pulldowns. Validation of interactions requires orthogonal methods like co-immunoprecipitation and co-localization studies. Analysis should consider that REEP3 has already demonstrated interactions with proteins like REEP1, REEP2, REEP4, and other network components .

How can researchers effectively use CRISPR-Cas9 to study REEP3 function in zebrafish models?

A methodological approach to CRISPR-Cas9 editing of zebrafish REEP3 should include:

  • Guide RNA design: Target conserved functional domains with multiple validated gRNAs

  • Delivery optimization: Compare microinjection of ribonucleoprotein complexes versus mRNA approaches

  • Mosaic analysis: Utilize F0 mosaics for rapid preliminary phenotyping before establishing stable lines

  • Validation strategies: Implement T7 endonuclease assays, sequencing, and protein expression analysis

When designing rescue experiments, researchers should use mRNA encoding recombinant REEP3 with silent mutations that prevent CRISPR targeting. Phenotypic analysis should include ER morphology assessment and cell division dynamics, aligning with REEP3's known functions in ER remodeling and mitosis .

What approaches are recommended for comparing the functions of REEP3 between zebrafish and mammalian models?

Methodological comparative approaches should include:

  • Cross-species complementation: Testing whether zebrafish REEP3 can rescue phenotypes in mammalian REEP3-knockout cells

  • Domain swapping experiments: Creating chimeric proteins with domains from zebrafish and mammalian REEP3

  • Comparative transcriptomics: RNA-seq analysis of REEP3-depleted zebrafish and mammalian cells to identify conserved and divergent pathways

Analysis should focus on evolutionary conservation of REEP3 function across vertebrates, with particular attention to conservation of protein-protein interactions identified in the REEP3 interaction network . This comparative approach provides insights into fundamental versus species-specific functions.

How can researchers investigate the potential role of REEP3 in zebrafish disease models?

Given REEP3's demonstrated role in human disease contexts like pancreatic cancer , methodological approaches for zebrafish disease modeling should include:

  • Transgenic overexpression: Generate tissue-specific REEP3 overexpression to model pathological conditions

  • Morphant/mutant phenotyping: Conduct detailed phenotypic analysis of REEP3-depleted zebrafish across multiple organ systems

  • Drug screening platforms: Develop REEP3-related phenotypic assays suitable for small molecule screening

Analysis should include detailed histopathology and molecular phenotyping, with particular focus on tissues where REEP3 shows enriched expression. The zebrafish model provides advantages for high-throughput screening approaches, similar to how zebrafish have been used for assessing "renal function, toxicity, and pharmacokinetics of nanoparticles" .

What are the main technical challenges in producing functional recombinant zebrafish REEP3 and how can they be addressed?

Common methodological challenges and solutions include:

ChallengeMethodological Solution
Low expression yieldOptimize codon usage for expression system; test different fusion tags (MBP, SUMO, Trx)
Protein aggregationScreen detergent conditions; reduce expression temperature; use solubility-enhancing buffers
Improper foldingExpress in eukaryotic systems with proper chaperone machinery
Proteolytic degradationAdd protease inhibitors throughout purification; identify and remove flexible regions
Loss of activity during storageTest cryoprotectants and stabilizing agents; optimize buffer conditions using thermal shift assays

When troubleshooting expression issues, consider performing expression trials comparing full-length REEP3 with truncated constructs focusing on specific domains identified through computational prediction algorithms.

How can researchers address data inconsistencies when comparing in vitro findings using recombinant REEP3 with in vivo observations in zebrafish?

Methodological approaches to reconcile data inconsistencies include:

  • Validate recombinant protein function: Confirm activity using established biochemical assays before making in vivo comparisons

  • Consider developmental context: Evaluate timing-dependent effects by testing multiple developmental stages

  • Address dose-response relationships: Establish physiologically relevant concentrations through careful calibration

  • Account for compensatory mechanisms: Investigate possible genetic compensation in knockout models using transcriptomic analysis

Analytical approaches should include careful statistical analysis to distinguish biological variation from technical artifacts. When designing experiments to resolve inconsistencies, researchers can apply principles used in zebrafish toxicology studies that employed multiple methodological approaches for validation .

What control experiments are essential when using recombinant zebrafish REEP3 for interaction studies?

Methodologically rigorous control experiments must include:

  • Negative controls: Irrelevant proteins of similar size and biochemical properties

  • Denatured protein controls: Heat-inactivated REEP3 to distinguish specific from non-specific interactions

  • Competing peptide controls: Unbiotinylated/untagged REEP3 to demonstrate binding specificity

  • Domain controls: Individual REEP3 domains to map interaction sites

When analyzing interaction data, researchers should implement quantitative analysis comparing enrichment over controls. Validation through orthogonal methods is essential, and consideration of the established REEP3 protein interaction network provides a framework for identifying expected versus novel interactions.

What are the promising research directions for studying REEP3's role in zebrafish development and disease?

Based on current knowledge, methodologically focused future directions include:

  • Tissue-specific knockouts: Generate conditional REEP3 mutants to bypass potential embryonic lethality

  • Intravital imaging: Develop transgenic reporters to monitor REEP3 activity in live embryos across development

  • Single-cell approaches: Implement scRNA-seq to identify cell populations with enriched REEP3 function

  • Disease modeling: Establish zebrafish models overexpressing or lacking REEP3 to recapitulate human pathologies

Particularly promising is exploring REEP3's potential role in immune cell function, given its correlation with immune cell infiltration shown in other contexts . The zebrafish model provides excellent opportunities for in vivo visualization of such processes, leveraging techniques like those described for other zebrafish studies using "fluorescent-based laser scanning microscopy and X-ray-based microtomography" .

How might advances in cryo-electron microscopy contribute to understanding zebrafish REEP3 structure-function relationships?

Methodological applications of cryo-EM for REEP3 structure determination include:

  • Sample preparation optimization: Develop protocols for reconstituting REEP3 in nanodiscs or amphipols

  • Single-particle analysis: Determine high-resolution structure of full-length REEP3

  • In situ structural studies: Implement cellular cryo-electron tomography to visualize REEP3 in native cellular contexts

Analysis should focus on identifying conformational states related to ER remodeling and interaction with binding partners. Comparative analysis with structures of other REEP family members would provide evolutionary context for conserved structural elements.

What integrative approaches might best advance understanding of REEP3 function across vertebrate species?

Methodologically integrative approaches should combine:

  • Multi-omics integration: Connect proteomics, transcriptomics, and metabolomics data across species

  • Cross-species phenotypic analysis: Develop equivalent phenotyping pipelines for REEP3 mutants across model organisms

  • Systems biology modeling: Generate predictive networks of REEP3 function based on multi-species data

These approaches can leverage existing knowledge about REEP3's involvement in protein-protein interaction networks while expanding to evolutionary context. Cross-species comparative analyses could identify core conserved functions versus species-specific adaptations, providing deeper understanding of fundamental biological processes involving REEP3.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.