Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1)

Shipped with Ice Packs
In Stock

Description

Retinal Development Studies

  • Transgenic zebrafish lines expressing opn1lw1 fusion proteins (e.g., LWS2-K) replicate endogenous retinal expression patterns, enabling real-time tracking of opsin localization in cone photoreceptors .

  • These models reveal spatiotemporal dynamics: opn1lw1 activates later in development, localizing to peripheral retinal regions, while opn1lw2 dominates central regions .

Disease Modeling

  • Used to study blue cone monochromacy and red-green color blindness caused by opsin gene recombination or LCR (locus control region) mutations .

  • Antibodies against opn1lw1 (e.g., Rabbit anti-Danio rerio IgG) enable Western blot and ELISA detection in disease phenotypes .

Transcriptional Regulation

  • A 0.6-kb LWS-activating region (LAR) upstream of opn1lw1 regulates both opn1lw1 and opn1lw2 expression, with LAR deletion abolishing peripheral retinal specificity .

Key Research Findings

  1. Opsin Switching: Tandem opn1lw1 and opn1lw2 genes share regulatory elements, allowing developmental stage-dependent expression switching .

  2. Subcellular Localization: Fusion proteins localize to photoreceptor outer segments (OS), confirmed via immunohistochemistry .

  3. Spectral Tuning: Amino acid substitutions at positions 180 (serine/alanine) and 230/233 (isoleucine/threonine) fine-tune wavelength sensitivity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting is recommended for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
opn1lw1; lws1; rdops; Red-sensitive opsin-1; Opsin-1, long-wave-sensitive 1; Opsin LWS-1; Red cone photoreceptor pigment 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
opn1lw1
Target Protein Sequence
MAEHWGDAIYAARRKGDETTREAMFTYTNSNNTKDPFEGPNYHIAPRWVYNVATVWMFFV VVASTFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETLFASTISVINQFFGYFILGH PMCIFEGYTVSVCGIAALWSLTVISWERWVVVCKPFGNVKFDAKWASAGIIFSWVWAAAW CAPPIFGWSRYWPHGLKTSCGPDVFSGSEDPGVQSYMVVLMITCCIIPLAIIILCYIAVY LAIHAVAQQQKDSESTQKAEKEVSRMVVVMIFAYCFCWGPYTFFACFAAANPGYAFHPLA AAMPAYFAKSATIYNPVIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA
Uniprot No.

Target Background

Function
Visual pigments are light-absorbing molecules crucial for vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Gene References Into Functions
  1. Individual long-wave sensitive cones switch from LWS2 to LWS1 expression in response to retinoic acid. PMID: 26296154
  2. These findings suggest that the LWS-activating region (LAR) regulates both LWS-1 and LWS-2 by enhancing their expression. The interaction of LAR with the promoters is competitive between the two genes in a developmentally restricted manner. PMID: 21187910
Database Links

KEGG: dre:30413

STRING: 7955.ENSDARP00000065940

UniGene: Dr.81279

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Retinal double cone principal photoreceptor cell outer segments.

Q&A

What is Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1)?

Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1) is a protein that functions as a photopigment in zebrafish, specifically in the red cone photoreceptors. It is one of two red opsin genes (LWS-1 and LWS-2) present in zebrafish that encode photopigments with distinct absorption spectra . The protein is officially recommended to be called "Red-sensitive opsin-1" but has alternative names including "Opsin-1, long-wave-sensitive 1" (Short name: Opsin LWS-1) and "Red cone photoreceptor pigment 1" . The protein is encoded by the opn1lw1 gene with synonyms including lws1 and rdops, and it consists of 357 amino acids forming a G-protein coupled receptor that responds to long-wavelength light .

How does the expression of opn1lw1 compare to opn1lw2 during zebrafish development?

The expression of opn1lw1 and opn1lw2 follows distinct temporal and spatial patterns during zebrafish development:

Opsin TypeInitial ExpressionEarly Expression PatternAdult Expression Pattern
opn1lw2 (LWS-2)40 hours post-fertilization (hpf)Begins as ventral patch, then spreads throughout retinaCentral to dorsal area of retina
opn1lw1 (LWS-1)3.5-5.5 days post-fertilization (dpf)Broad area in marginal side of ventral retinaVentral and peripheral areas of retina

This developmental sequence indicates that opn1lw2 expression precedes opn1lw1, despite early studies incorrectly identifying LWS-1 as the sole red opsin in zebrafish . This temporal distinction suggests potential functional differences between the two red opsins during visual system development .

What are the optimal storage conditions for Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1)?

For optimal protein stability and functionality, Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1) should be stored in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein . Standard storage recommendations include:

  • Short-term storage: Store working aliquots at 4°C for up to one week

  • Medium-term storage: Store at -20°C

  • Long-term storage: Store at -20°C or -80°C

To maintain protein integrity, repeated freezing and thawing cycles should be strictly avoided as they can lead to protein denaturation and loss of activity . Researchers should prepare small working aliquots upon initial thawing to minimize freeze-thaw cycles.

What mechanisms regulate the spatial and temporal differences in LWS-1 and LWS-2 expression in the zebrafish retina?

The differential expression of LWS-1 and LWS-2 in the zebrafish retina involves complex regulatory mechanisms that remain under investigation. Current evidence indicates that both spatial and temporal regulation contribute to their expression patterns . The short-wavelength subtype (LWS-2) is expressed earlier in development and predominantly in central to dorsal retinal areas, while the longer-wavelength subtype (LWS-1) appears later and is expressed primarily in ventral and peripheral retinal regions .

This pattern suggests that:

  • Developmental timing mechanisms regulate sequential activation, with LWS-2 expressed at 40 hpf and LWS-1 not until 3.5-5.5 dpf

  • Spatial regulatory elements direct expression to specific retinal regions

  • The regulation may involve similar mechanisms to green opsins, which show comparable spatiotemporal patterning

These expression patterns likely optimize visual function based on the specific light environment each retinal region typically encounters in the natural habitat . Further research using transgenic approaches with fluorescently tagged proteins can elucidate the regulatory elements controlling these expression patterns .

How do the temporal patterns of opsin expression relate to the morphological development of cone photoreceptors in zebrafish?

An intriguing paradox exists between opsin expression and morphological cone development in zebrafish. While red opsin (LWS) expression begins first at 51 hpf, followed by blue opsin, and finally UV opsin after 55 hpf, the morphological maturation occurs in the reverse order . UV cones appear morphologically mature by 6-7 days post-fertilization, while red cones do not achieve adult-like morphology until 15-20 days post-fertilization .

This developmental disconnect suggests:

  • Opsin expression and structural development of cones are regulated by independent genetic mechanisms

  • The temporal sequence of opsin expression may prioritize establishing spectral sensitivity before structural optimization

  • The extended period between initial expression and morphological maturation for red cones (approximately 2 weeks) may relate to the complex tuning mechanisms required for long-wavelength sensitivity

This pattern presents a valuable model system for studying the dissociation between gene expression and cellular morphogenesis in neural development .

What are the spectral and functional differences between LWS-1 and LWS-2 opsins, and how do they contribute to zebrafish vision?

The LWS-1 and LWS-2 opsins in zebrafish exhibit distinct spectral sensitivities despite their high sequence homology (93% identity in coding regions) . While specific absorbance maxima are not directly provided in the search results, research indicates that:

  • LWS-1 is tuned to longer wavelengths than LWS-2

  • The spatial distribution in the adult retina creates a dorsal-ventral gradient of spectral sensitivity

  • This distribution likely optimizes vision for different light environments (surface water vs. deeper water)

The functional significance of having two red opsins with different spectral properties and expression patterns may relate to the natural light environment of zebrafish, where downwelling light from the water surface differs in spectral composition from light in the horizontal visual field . This spectral tuning likely provides ecological advantages for prey detection, predator avoidance, and mate selection across different visual environments.

What experimental approaches can be used to study opn1lw1 expression in developing zebrafish retina?

Several complementary methodological approaches are effective for investigating opn1lw1 expression:

TechniqueApplicationAdvantagesLimitations
In situ hybridizationTemporal and spatial expression patternsHigh specificity using 3'-UTR probes (48% identity between LWS-1 and LWS-2)Does not show protein localization
Transgenic reporter linesReal-time visualization of expressionAllows live imaging; can track cellular developmentMay not perfectly recapitulate endogenous expression
ImmunohistochemistryProtein localizationShows actual protein distributionRequires specific antibodies
RT-PCR/qPCRQuantitative expression analysisPrecise quantification of transcript levelsLacks spatial information

For distinguishing between the highly homologous LWS-1 and LWS-2 transcripts, using 3'-UTR probes for in situ hybridization has proven effective due to the 48% identity between these regions, compared to 93% identity in coding regions . The generation of transgenic lines with fluorescently tagged opsins (such as Opn1lw1-mNeonGreen) provides a powerful tool for tracking expression in living specimens throughout development .

How can researchers effectively use recombinant opn1lw1 protein in functional studies?

Recombinant Danio rerio Red-sensitive opsin-1 (opn1lw1) protein can be effectively utilized in various functional studies with the following considerations:

  • Protein reconstitution: For spectroscopic studies, reconstitute the protein with 11-cis-retinal to form the functional photopigment

  • Buffer optimization: Maintain in Tris-based buffer with 50% glycerol to preserve stability

  • Temperature considerations: Conduct functional assays at temperatures approximating zebrafish physiological conditions (28-30°C)

  • Light exposure: Minimize exposure to bright light during handling to prevent photoisomerization

  • G-protein coupling assays: Can be used to study signaling mechanisms by measuring activation of appropriate G-proteins

When designing experiments, researchers should consider that the full-length protein (amino acids 1-357) includes seven transmembrane domains characteristic of G-protein coupled receptors, making it potentially challenging to work with in aqueous solutions . Inclusion of appropriate detergents or lipid nanodisc technologies may improve functionality in biochemical assays.

What considerations should guide the design of gene expression studies comparing opn1lw1 with other opsin subtypes?

When designing studies to compare opn1lw1 expression with other opsin subtypes, researchers should consider:

  • Temporal coordination: Account for the sequential expression pattern (red opsins starting at 40-51 hpf, blue later, and UV last)

  • Spatial distribution: Design sampling strategies that capture dorsal-ventral and central-peripheral gradients

  • Primer/probe specificity: Design highly specific primers/probes, especially for distinguishing between the highly homologous LWS-1 and LWS-2

  • Developmental staging: Use precise staging criteria, as expression patterns change rapidly during development

  • Reference genes: Select appropriate reference genes that maintain stable expression throughout retinal development

Additionally, researchers should consider that opsin expression patterns may be influenced by environmental factors such as light conditions during rearing, which should be standardized across experimental groups . The reversed relationship between expression onset and morphological maturation also necessitates parallel assessment of both molecular and structural development for comprehensive understanding .

What are the most significant unanswered questions and future research directions regarding zebrafish red-sensitive opsins?

Several important questions remain to be fully addressed regarding zebrafish red-sensitive opsins:

  • Regulatory mechanisms: What specific transcription factors and enhancer elements control the precise spatiotemporal expression patterns of LWS-1 and LWS-2?

  • Functional significance: How does the differential expression of two red opsins contribute to zebrafish visual ecology and behavior?

  • Evolutionary perspective: What selective pressures drove the duplication and divergence of red opsin genes in zebrafish compared to other vertebrates?

  • Developmental regulation: What mechanisms explain the paradoxical relationship between opsin expression timing and morphological maturation of cone cells?

  • Spectral tuning: Which specific amino acid substitutions account for the spectral differences between LWS-1 and LWS-2?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.