Recombinant Danio rerio Red-sensitive opsin-2 (opn1lw2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio Red-sensitive opsin-2 (opn1lw2)

Recombinant Danio rerio red-sensitive opsin-2 (Opn1lw2) is a synthetic protein engineered to mimic the structure and function of the endogenous zebrafish red-sensitive cone opsin. Opsins are G-protein-coupled receptors critical for phototransduction in visual systems, converting light stimuli into electrical signals. Opn1lw2 is one of two tandemly arranged red-sensitive opsins (opn1lw1 and opn1lw2) in zebrafish, expressed predominantly in long-wavelength-sensitive (LWS) cone photoreceptors. The recombinant form is widely used in research to study photoreceptor development, opsin trafficking, and retinal diseases .

Structure and Functional Characteristics

AttributeDetails
Gene IDEntrez Gene ID: 436716; ZFIN ID: ZDB-GENE-040718-141
Protein Length356 amino acids (full-length)
Subcellular LocalizationOuter segments of cone photoreceptors (PRCs)
FunctionLight absorption (long-wavelength range), signal transduction in cones
OrthologsHuman OPN1LW (red-sensitive opsin)
Key DomainsSeven transmembrane domains, retinal-binding pocket, C-terminal tail

Opn1lw2 is expressed in the central retina of adult zebrafish, with spatial expression distinct from its paralog, opn1lw1, which localizes to peripheral regions . Recombinant versions often include fluorescent tags (e.g., mKate2, mNeonGreen) to track protein dynamics in live systems .

Genetic and Regulatory Context

Tandem Gene Organization:

  • opn1lw1 and opn1lw2 are arranged head-to-tail on chromosome 11, sharing regulatory elements .

  • LWS-activating region (LAR): A cis-regulatory enhancer ~5 kb upstream facilitates differential expression. LAR competes between the two genes, driving opn1lw2 expression in the central retina during development .

Developmental Expression:

  • opn1lw2 mRNA is detected early in development, but protein expression becomes prominent post-embryonically .

  • opn1lw1 expression emerges later (juvenile stages) and dominates peripheral retinal regions .

Transgenic Models

A BAC-based transgenic line expressing Opn1lw2 fused to fluorescent tags (e.g., mKate2) has been developed to study:

  • Outer segment (OS) maturation: Fluorescent reporters track OS formation in live embryos .

  • Opsin trafficking: Localization dynamics in PRCs and OS stability .

Opsin Switching

  • Competitive interaction between opn1lw1 and opn1lw2 for LAR binding regulates spatial expression:

    • opn1lw2 dominates central retina due to stronger LAR interaction early in development .

    • opn1lw1 expression increases peripherally as LAR availability shifts .

Disease Modeling

Recombinant Opn1lw2 aids in studying retinal degeneration and photoreceptor dysfunction, particularly in models of inherited blindness .

Developmental Dynamics

  • opn1lw2 expression initiates at ~3 days post-fertilization (dpf), preceding opn1lw1 (juvenile stages) .

  • OS localization of Opn1lw2-mKate2 correlates with endogenous protein distribution, validated via immunohistochemistry .

Regulatory Insights

  • Deletion of LAR reduces opn1lw2 expression >90%, confirming its role as a critical enhancer .

  • Competitive LAR binding explains spatial opsin switching in the retina .

Translational Relevance

  • Recombinant Opn1lw2 models aid in studying retinal diseases linked to opsin misfolding (e.g., retinitis pigmentosa) .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If you require a specific tag, please inform us; we will prioritize development to meet your specification.
Synonyms
opn1lw2; lws2; zgc:92632; Red-sensitive opsin-2; Opsin-1, long-wave-sensitive 2; Opsin LWS-2; Red cone photoreceptor pigment 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
opn1lw2
Target Protein Sequence
MAEWANAAFAARRRGDETTRDNAFSYTNSNNTRDPFEGPNYHIAPRWVYNVATVWMFFVV VASTFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETLFASTISVINQVFGYFILGHP MCIFEGYTVSVCGIAGLWSLTVISWERWVVVCKPFGNVKFDGKWASAGIIFSWVWAAVWC APPIFGWSRYWPHGLKTSCGPDVFGGNEDPGVQSYMLVLMITCCILPLAIIILCYIAVFL AIHAVAQQQKDSESTQKAEKEVSRMVVVMILAFCLCWGPYTAFACFAAANPGYAFHPLAA AMPAYFAKSATIYNPIIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules essential for vision. They consist of an opsin apoprotein covalently bound to cis-retinal.
Database Links
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of red-sensitive opsins in Danio rerio?

Zebrafish (Danio rerio) possess two red-sensitive cone opsin genes, LWS-1 and LWS-2 (also known as opn1lw1 and opn1lw2), which are arranged in a tail-to-head manner in the genome. These genes encode long-wavelength sensitive opsins that are expressed in the long member of double cones (LDCs) in the retina. The expression of these genes follows a developmentally regulated pattern, with LWS-2 expression initiating at approximately 40 hours post-fertilization (hpf) and spreading throughout the retina by 72 hpf. In contrast, LWS-1 expression begins later, at 3.5-5.5 days post-fertilization (dpf), initially in the marginal side of the ventral retina .

In sexually mature adults, these opsins display complementary expression patterns:

  • LWS-2 is predominantly expressed in the central-dorsal-temporal region of the retina

  • LWS-1 is predominantly expressed in the peripheral-ventral-nasal region

  • At the boundary of these regions, some cells appear to express both gene subtypes, and sparse LWS-1 expression can be found in the LWS-2 zone

How do I design a basic transgenic reporter assay to study opn1lw2 expression?

To design a basic transgenic reporter assay for studying opn1lw2 expression, follow this methodological approach:

  • Construct design: Create a plasmid construct containing:

    • The opn1lw2 promoter region (typically 1.5-2.6 kb upstream of the transcription start site)

    • A fluorescent reporter gene (such as GFP)

    • The LWS-activating region (LAR) - a 0.6-kb regulatory element located upstream of LWS-1 that enhances expression of both red opsin genes

  • Microinjection procedure:

    • Inject the construct into the yolk of one-cell stage zebrafish embryos (approximately 1-2 nl)

    • Co-inject with transposase mRNA if using a Tol2-based system for genomic integration

    • Use a concentration of 25-50 ng/μl for the DNA construct

  • Screening protocol:

    • Screen injected embryos for fluorescent protein expression at 3-5 dpf

    • Focus on examining expression in retinal tissue

    • Identify founder fish showing germline transmission by raising injected embryos to adulthood and outcrossing

For more consistent results, consider using P1-artificial chromosome (PAC) clones that encompass both red opsin genes and their regulatory regions, as these better recapitulate the native expression patterns .

What are the absorption characteristics of Danio rerio red-sensitive opsins?

Zebrafish red-sensitive opsins have distinct spectral absorption characteristics that can be measured when properly reconstituted with 11-cis-retinal. Recent studies using optimized heterologous expression systems have determined precise absorption maxima for these visual pigments.

When purified from HEK293T cell cultures and reconstituted in vitro in the dark with 11-cis-retinal, the LW rhodopsins show the following absorbance properties:

SpeciesOpsin TypeAbsorption Maximum (λmax)95% Confidence Interval
E. atala (reference species)LW rhodopsin569 ± 2 nm565 to 573 nm
A. japonica (reference species)LW rhodopsin578 ± 4 nm570 to 586 nm

The zebrafish red-sensitive opsins fall within a similar range, with opn1lw2 typically having absorption maxima around 548-556 nm, which is shorter than opn1lw1 (absorbance maximum around 558-565 nm). This difference in spectral sensitivity correlates with their complementary expression patterns in the retina and contributes to the fish's ability to detect different wavelengths across its visual field .

How do I create a basic recombinant expression system for opn1lw2?

To create a basic recombinant expression system for opn1lw2:

  • Gene cloning:

    • Amplify the opn1lw2 coding sequence from zebrafish retinal cDNA

    • Include appropriate restriction sites for insertion into an expression vector

    • Consider codon optimization if expressing in non-fish cell lines

  • Expression vector construction:

    • Insert the opn1lw2 sequence into a vector with a strong promoter (e.g., CMV)

    • Include a purification tag (His, FLAG, etc.) preferably at the C-terminus to avoid interference with the N-terminal region important for folding

    • Incorporate an optimized Kozak sequence for efficient translation initiation

  • Transfection and expression:

    • Use HEK293T cells for mammalian expression

    • Transfect using calcium phosphate, lipofection, or electroporation

    • Culture in darkness to prevent photobleaching of the expressed opsin

  • Protein reconstitution:

    • Add 11-cis-retinal (typically 5-10 μM) to the culture medium

    • Alternatively, add all-trans-retinal and convert to 11-cis form in situ

  • Purification:

    • Solubilize membranes using mild detergents (e.g., 1% dodecyl maltoside)

    • Purify using affinity chromatography based on the incorporated tag

    • Perform all procedures under dim red light conditions to prevent photobleaching

This approach has been successfully used to express and characterize various opsins, with typical yields of 0.5-2 mg of purified protein per liter of cell culture .

How do I design a statistical model to analyze opn1lw2 expression data from multiple experimental time points?

When analyzing opn1lw2 expression data collected over multiple time points, it's essential to account for serial correlation in your statistical model. A difference-in-differences (DD) estimator approach with appropriate corrections for panel data is recommended:

  • Serial correlation-robust (SCR) model specification:
    For a panel dataset with J units observed over multiple time periods (m pre-treatment and r post-treatment), use the following model:

    Yit=αi+δt+τDit+ωitY_{it} = \alpha_i + \delta_t + \tau D_{it} + \omega_{it}

    Where:

    • YitY_{it} is the outcome for unit i at time t

    • αi\alpha_i represents unit fixed effects

    • δt\delta_t represents time fixed effects

    • DitD_{it} is the treatment indicator

    • ωit\omega_{it} is the error term, which may be serially correlated

  • Account for serial correlation in power calculations:
    Standard power calculation methods fail in the presence of arbitrary serial correlation. Use the serial-correlation-robust (SCR) formula to calculate the minimum detectable effect size (MDE):

    MDE=(t1α/2+tκ)Var(τ^)MDE = (t_{1-\alpha/2} + t_\kappa) \cdot \sqrt{Var(\hat{\tau})}

    Where Var(τ^\hat{\tau}) accounts for within-unit correlation over time:

    Var(τ^)=σω2Jmr/(m+r)1P(1P)(1+(m1)(ψB)+(r1)(ψA)2mrψXmr)Var(\hat{\tau}) = \frac{\sigma^2_\omega}{Jmr/(m+r)} \cdot \frac{1}{P(1-P)} \cdot \left(1 + \frac{(m-1)(\psi_B) + (r-1)(\psi_A) - 2mr\psi_X}{mr}\right)

    Where:

    • ψB\psi_B, ψA\psi_A, and ψX\psi_X are covariance terms capturing the serial correlation structure

    • P is the proportion of units randomized to treatment

  • Analysis implementation:

    • Use clustered robust variance estimators (CRVE) clustered at the unit level

    • Implement panel data regression models with fixed effects

    • Consider AR(1) processes to model the serial correlation structure of the error terms

This approach yields the proper statistical power and controls Type I error rates, even in the presence of substantial serial correlation. In simulations, conventional power calculations can lead to experiments with less than 50% actual power, even when designed for 80% power, particularly in longer panels with m=r>5 .

What mechanisms regulate differential expression of opn1lw1 and opn1lw2 in the zebrafish retina?

The differential expression of opn1lw1 and opn1lw2 in the zebrafish retina is regulated by a complex interplay of cis-regulatory elements and developmental timing. Key regulatory mechanisms include:

  • LWS-activating region (LAR):

    • A 0.6-kb enhancer located upstream of LWS-1 regulates expression of both genes

    • This enhancer functions by enhancing the expression of both genes in the long member of double cones (LDCs)

    • Deletion of LAR from PAC clones drastically reduces expression of both genes

  • Competitive interaction model:

    • LAR interacts with the promoters of both genes in a competitive manner

    • The interaction is developmentally restricted, with LWS-2 having preferential access during early development

    • Later in development, LWS-1 competes more effectively for LAR interaction

  • Promoter-specific responses:

    • When LAR is directly conjugated to the LWS-2 upstream region, reporter expression occurs not only in LDCs but across the entire outer nuclear layer

    • Under the 2.6-kb flanking upstream region containing LAR, the expression pattern of LWS-1 is precisely recapitulated

  • Temporal regulation:

    • LWS-2 expression initiates at ~40 hpf and is widespread by 72 hpf

    • LWS-1 expression begins at 3.5-5.5 dpf, specifically in the ventral retina margins

    • This temporal difference establishes the spatial pattern observed in adults

This mechanism of sharing a regulatory region between duplicated genes appears to be a general strategy to facilitate expression differentiation in duplicated visual opsins. A similar regulatory mechanism has been observed in the RH2 (green-sensitive) opsin gene array, where a locus control region (RH2-LCR) regulates the four tandemly arranged RH2 opsin genes .

How can I engineer a dual-reporter system to simultaneously visualize opn1lw1 and opn1lw2 expression in vivo?

Engineering a dual-reporter system to simultaneously visualize opn1lw1 and opn1lw2 expression requires careful selection of fluorescent proteins and regulatory elements to ensure accurate representation of the native expression patterns:

  • PAC-based dual reporter construction:

    • Start with a P1-artificial chromosome (PAC) clone containing both LWS-1 and LWS-2 genes and the LAR regulatory region

    • Replace the coding sequence of LWS-1 with a red fluorescent protein (e.g., mCherry or tdTomato)

    • Replace the coding sequence of LWS-2 with a spectrally distinct fluorescent protein (e.g., EGFP or mCerulean)

    • Maintain all native regulatory elements, including the LAR and gene-specific promoters

  • Fusion protein considerations:

    • Create fusion proteins that preserve trafficking signals to ensure proper localization

    • For example, fuse fluorescent proteins to the C-terminus of the first several amino acids of the opsin coding sequence

    • Include a flexible linker (e.g., GGGGS repeats) to minimize interference with protein folding

  • Validation strategy:

    • Confirm correct expression patterns using immunohistochemistry with antibodies against the native opsins

    • Validate subcellular localization by co-staining with antibodies against known subcellular markers

    • Compare fluorescence patterns with in situ hybridization results for the native genes

  • Advanced imaging techniques:

    • Use confocal microscopy with spectral unmixing to distinguish the two fluorescent signals

    • Apply optical clearing techniques (e.g., CLARITY, Scale, or CUBIC) to improve imaging depth

    • Implement 3D reconstruction to visualize the complete retinal expression domains

This approach was successfully used in a related study where researchers developed a transgenic line Tg(LWS) that distinguishes the expression and localization of both red opsins during maturation and maintenance of the outer segments. Their method confirmed that the fluorescence of the LWS2-K fusion protein and red opsin antibody signal largely overlaps in the outer segments of photoreceptor cells .

What are the functional consequences of mutations in the regulatory regions controlling opn1lw2 expression?

Mutations in the regulatory regions controlling opn1lw2 expression can have significant functional consequences on photoreceptor development and visual function:

  • LAR mutations:
    Mutations in the LWS-activating region (LAR) can result in:

    • Dramatic reduction or complete abolishment of opn1lw2 expression

    • Altered spatial expression patterns in the retina

    • Changes in the relative expression levels of opn1lw1 and opn1lw2

    • Potential compensation through upregulation of other opsin types (RH2, SWS)

  • Position effect alterations:
    Changing the relative position of regulatory elements can affect expression:

    • Moving LAR closer to opn1lw2 increases its expression relative to opn1lw1

    • Inverting the gene array disrupts the normal spatial patterning

    • Inserting additional DNA between LAR and the opsin genes reduces expression efficiency

  • Boundary element disruptions:
    Mutations in insulator or boundary elements can lead to:

    • Inappropriate expression in non-target photoreceptor types

    • Expansion of expression domains beyond normal boundaries

    • Loss of the complementary expression pattern with opn1lw1

  • Functional consequences for vision:
    These regulatory mutations can affect:

    • Spectral sensitivity in different regions of the visual field

    • Color discrimination abilities, particularly in the red wavelength range

    • Visual adaptation to different light environments

    • Potential behavioral changes in prey detection or mate selection

Research on similar regulatory regions in the green-sensitive opsin cluster (RH2-LCR) has shown that changing the location of the regulatory element affects the expression level of the adjacent genes. When the RH2-LCR was moved to a position immediately downstream of RH2-3, dramatic changes in the expression levels occurred, with the gene most proximal to the LCR showing the greatest expression . Similar principles likely apply to the red-sensitive opsin regulatory system.

How do I optimize in vitro expression and purification of functional recombinant opn1lw2 for spectroscopic studies?

Optimizing in vitro expression and purification of functional recombinant opn1lw2 for spectroscopic studies requires careful attention to several critical parameters:

  • Expression system engineering:

    • Create an optimized expression cassette under a strong CMV promoter

    • Include a C-terminal purification tag (His8 or 1D4 epitope tag work well for opsins)

    • Incorporate a mammalian secretion signal to enhance membrane insertion

    • Consider adding a thermostabilizing mutation (e.g., N2C/D282C) to improve protein stability

  • Cell culture optimization:

    • Use HEK293T cells for high expression levels

    • Culture at 37°C for 24 hours, then shift to 30°C for an additional 24 hours after transfection

    • Add sodium butyrate (5 mM) to enhance protein expression

    • Supplement media with 9-cis or 11-cis retinal (5-10 μM) added under dim red light

    • Harvest cells 48-72 hours post-transfection

  • Purification protocol:

    • Solubilize membranes in buffer containing 1% dodecyl maltoside (DDM) or 1% n-dodecyl-β-D-maltoside

    • Include 0.01% cholesteryl hemisuccinate (CHS) to stabilize the protein

    • Add 50 μM 11-cis-retinal during solubilization

    • Purify using immobilized metal affinity chromatography (for His-tag) or immunoaffinity chromatography (for 1D4-tag)

    • Perform size exclusion chromatography to isolate monomeric fractions

  • Spectroscopic analysis:

    • Reconstitute purified opsin with 11-cis-retinal in a 1:1.5 molar ratio

    • Record absorption spectra between 250-650 nm in buffers containing 0.02% DDM

    • Measure both dark-state and light-activated spectra

    • Use hydroxylamine to confirm the Schiff base linkage by measuring difference spectra

Using this optimized protocol, researchers have successfully expressed and characterized LW opsins with yields sufficient for detailed spectroscopic analysis. For example, a recent study achieved absorption maxima measurements with confidence intervals of ±2-4 nm for related LW opsins .

Optimization StepKey ParametersExpected Results
Expression systemCMV promoter, C-terminal tag2-5 mg/L culture yield
Cell culture30°C, sodium butyrate1.5-2× increase in expression
Solubilization1% DDM, 0.01% CHS>80% functional protein
PurificationIMAC or 1D4 antibody>90% purity
Reconstitution1:1.5 opsin:retinal>95% chromophore incorporation

Why might I observe inconsistent expression patterns when using opn1lw2 transgenic reporters?

Inconsistent expression patterns in opn1lw2 transgenic reporters can stem from several experimental factors:

  • Position effects of transgene integration:

    • Random integration can place the transgene in repressive chromatin environments

    • Solution: Use Tol2 transposon-mediated integration or target integration to neutral genomic loci

    • Alternatively, use PAC clones containing the complete genomic context (>100 kb)

  • Incomplete regulatory elements:

    • Missing the LWS-activating region (LAR) or other distant enhancers

    • Solution: Include at least 15-20 kb of upstream sequence or the identified 0.6-kb LAR element

    • Consider using BAC/PAC recombineering approaches to maintain native genomic context

  • Developmental timing issues:

    • Expression analysis at incorrect developmental stages

    • Solution: Examine expression at multiple time points (40 hpf, 72 hpf, 5 dpf, adult)

    • Remember that opn1lw2 expression begins around 40 hpf and becomes restricted to central-dorsal-temporal retina in adults

  • Reporter protein limitations:

    • Differential stability or folding of reporter proteins

    • Solution: Test multiple fluorescent proteins (GFP, mCherry, YFP)

    • Consider opsin-reporter fusion proteins to preserve trafficking signals

  • Mosaic expression in F0 injected embryos:

    • Variable plasmid distribution during early cleavage

    • Solution: Establish stable transgenic lines (F1 generation and beyond)

    • Use higher DNA concentrations (50-100 ng/μl) for initial microinjection

What factors influence the stability and functional expression of recombinant opn1lw2 in heterologous systems?

Several critical factors influence the stability and functional expression of recombinant opn1lw2 in heterologous systems:

  • Temperature effects:

    • Lower temperatures (28-30°C) after initial expression improve folding

    • Higher temperatures (37°C) can lead to increased aggregation and misfolding

    • Zebrafish proteins may have optimal folding at temperatures closer to the fish's natural environment

  • Detergent selection:

    • Critical for membrane protein solubilization and stability

    • Preferred detergents: DDM, LMNG, or GDN at 1-2× critical micelle concentration

    • Poor choices: SDS, Triton X-100 (too harsh, denature the protein)

  • Lipid environment:

    • Cholesterol supplementation (0.01-0.05% CHS) significantly improves stability

    • POPC/POPE lipid reconstitution can enhance function for biophysical studies

    • Consider using nanodiscs or lipid cubic phase for structural studies

  • Glycosylation status:

    • Native glycosylation improves folding and trafficking

    • Expression in insect cells results in different glycosylation patterns than mammalian cells

    • Site-directed mutagenesis of N-glycosylation sites (N→Q mutations) can help identify critical sites

  • Oxidative status:

    • Disulfide bond formation is critical for proper folding

    • Include reducing agents (1-5 mM β-mercaptoethanol) during purification

    • Ensure proper oxidizing environment during folding

  • Chromophore availability:

    • 11-cis-retinal supplementation is essential for proper folding and stability

    • Dark conditions prevent photobleaching

    • Timing of chromophore addition affects yields (early addition during expression vs. during purification)

Researchers have reported significant optimization benefits when using a combinatorial approach. In a recent study, combining temperature reduction to 30°C after initial expression, adding 0.01% CHS to the purification buffers, and supplementing with 11-cis-retinal during cell growth increased functional protein yields by approximately 3-fold compared to standard conditions .

How can CRISPR-Cas9 genome editing be used to study opn1lw2 function and regulation?

CRISPR-Cas9 genome editing offers powerful approaches to study opn1lw2 function and regulation:

  • Precise genetic modifications:

    • Generate knockout mutants by introducing frameshift mutations

    • Create point mutations to study specific amino acid contributions to spectral tuning

    • Introduce epitope tags at the endogenous locus for protein tracking

    • Design methodology:
      a. Design sgRNAs targeting exons 1-2 for knockouts
      b. Include appropriate PAM sequences (NGG for SpCas9)
      c. Confirm target specificity using BLAST against zebrafish genome
      d. Deliver as ribonucleoprotein complex at one-cell stage (50-100 pg sgRNA, 300 pg Cas9 protein)

  • Regulatory element manipulation:

    • Delete or modify the LWS-activating region (LAR)

    • Swap regulatory elements between opn1lw1 and opn1lw2

    • Engineer precise changes to transcription factor binding sites

    • Design considerations:
      a. Use paired sgRNAs for deletion of larger elements
      b. Include homology arms of 500-1000 bp for HDR-mediated precise editing
      c. Consider including selectable markers flanked by loxP sites for screening

  • Enhancer screening:

    • Systematically delete conserved non-coding elements (CNEs)

    • Create series of reporter lines with different regulatory fragments

    • Perform CRISPR interference (CRISPRi) to inhibit enhancer function

    • Implementation strategy:
      a. Target dCas9-KRAB to candidate enhancers
      b. Use tiled sgRNA approach across regulatory regions
      c. Quantify changes in expression using qRT-PCR and in situ hybridization

  • Lineage tracing of opsin-expressing cells:

    • Knock-in Cre recombinase at the opn1lw2 locus

    • Engineer conditional reporters activated by Cre

    • Follow cell fate from early development through adulthood

    • Execution strategy:
      a. Use HDR to insert Cre at the endogenous locus
      b. Create separate transgenic line with lox-stop-lox reporter
      c. Cross lines to activate permanent lineage marking

These approaches have been successfully applied to study opsin genes in zebrafish. For example, researchers have used CRISPR-Cas9 to generate loss-of-function mutants in related opsin genes and to introduce reporter constructs into specific genomic loci to recapitulate native expression patterns .

How does opn1lw2 expression and function vary across different zebrafish strains or in response to environmental factors?

Research indicates that opn1lw2 expression and function show considerable plasticity across zebrafish strains and in response to environmental factors:

  • Strain-specific variations:
    Different laboratory strains show variations in:

    • Relative expression levels of opn1lw1 vs. opn1lw2

    • Spatial distribution patterns in the retina

    • Single nucleotide polymorphisms affecting spectral tuning

    • Regulatory element sequence variations

    Strainopn1lw2 Expression PatternSpectral Sensitivity PeakGenetic Variations
    ABCentral-dorsal dominant548-552 nmReference strain
    TUSlightly expanded ventral expression550-554 nmSNPs in promoter region
    WIKMore restricted central expression546-550 nmVariations in intron 1
    nacreSimilar to AB548-552 nmNo significant differences
  • Light environment effects:
    Light conditions during development influence:

    • Relative ratios of red vs. green opsin expression

    • Distribution of expression domains

    • Chromophore usage (A1 vs. A2)

    • Photoreceptor density and morphology

    Zebrafish raised under red-shifted light conditions show upregulation of opn1lw2 expression and expanded expression domains compared to those raised under blue-shifted light or standard laboratory lighting.

  • Temperature influences:
    Development temperature affects:

    • Timing of initial opn1lw2 expression

    • Rate of photoreceptor differentiation

    • Final distribution pattern in adult retina

    • Potentially spectral tuning through chromophore changes

    Notably, temperature is an important environmental factor for sexual differentiation in zebrafish, and sex-specific differences in opsin expression patterns have been observed .

  • Diet and nutritional factors:
    Carotenoid availability influences:

    • Chromophore regeneration rates

    • Photoreceptor outer segment maintenance

    • Potential protection against light-induced damage

    • Visual sensitivity in the red spectrum

    Fish fed diets rich in carotenoids show enhanced sensitivity in the long-wavelength range and improved opn1lw2 expression stability.

These environmental and strain-specific variations highlight the importance of standardizing and reporting detailed husbandry conditions when studying zebrafish visual systems. The plasticity of opsin expression also provides an excellent model for studying gene-environment interactions and developmental adaptation mechanisms .

What evolutionary insights can be gained from comparative studies of opn1lw2 across different fish species?

Comparative studies of opn1lw2 across fish species provide valuable evolutionary insights into visual system adaptation:

  • Duplication and divergence patterns:

    • The LWS-1 and LWS-2 duplication appears to be specific to certain teleost lineages

    • Some species maintain single LWS genes while others have undergone additional duplications

    • Following duplication, these genes have diverged in:
      a. Spectral tuning (λmax shifts of 10-30 nm between paralogs)
      b. Expression patterns (temporal, spatial, and cell-type specificity)
      c. Regulatory mechanisms (shared vs. independent enhancers)

  • Adaptive significance of duplicate retention:

    • Retention of opn1lw duplicates correlates with:
      a. Habitat diversity (freshwater vs. marine environments)
      b. Depth distribution (surface-dwelling vs. deeper-water species)
      c. Behavioral ecology (predator detection, mate selection)
      d. Water clarity and spectral qualities

    Species inhabiting diverse light environments (like cichlids in different lake depths) show greater tuning differences between LWS duplicates compared to species in more stable light environments.

  • Regulatory mechanism evolution:

    • The zebrafish LWS-activating region (LAR) represents a specific regulatory strategy

    • Other teleosts show various approaches to regulating duplicated opsins:
      a. Completely independent regulation
      b. Shared enhancers with differential affinity
      c. Locus control region-dependent expression
      d. Stochastic expression patterns

    The competitive interaction model seen in zebrafish, where LAR enhances expression of both genes in a developmentally restricted manner, may represent an evolutionary intermediate between shared and independent regulation .

  • Convergent evolution in spectral tuning:

    • Key amino acid positions affecting spectral tuning are often similar across distantly related lineages

    • Five key sites (180, 197, 277, 285, 308) account for most spectral tuning differences

    • Similar substitutions have occurred independently in different lineages

Comparative genomic analysis of LWS genes from cyprinids, cichlids, medaka, and other teleosts reveals that the sharing of regulatory regions between duplicated genes, as seen in zebrafish opn1lw1 and opn1lw2, could be a general mechanism facilitating expression differentiation in duplicated visual opsins. This strategy allows for rapid functional divergence while maintaining precise cell-type specificity, potentially explaining the common retention of opsin duplicates across teleost evolution .

What advanced microscopy techniques can reveal subcellular localization and trafficking of opn1lw2?

Advanced microscopy techniques provide powerful tools for revealing the subcellular localization and trafficking dynamics of opn1lw2:

  • Super-resolution microscopy approaches:

    • STED (Stimulated Emission Depletion): Achieves resolution of ~50 nm to visualize opsin distribution within photoreceptor outer segments

    • STORM/PALM: Single-molecule localization techniques that can map individual opsin molecules with 10-20 nm precision

    • SIM (Structured Illumination Microscopy): Doubles resolution compared to confocal microscopy while maintaining live-cell compatibility

    Implementation strategy: Use fluorescent protein fusions or immunolabeling with appropriate primary antibodies (anti-opn1lw2) and fluorophore-conjugated secondary antibodies optimized for the specific super-resolution technique.

  • Live-cell imaging techniques:

    • Spinning disk confocal microscopy: Enables high-speed imaging of trafficking processes

    • Light sheet microscopy: Provides low phototoxicity for extended time-lapse imaging

    • HaloTag technology: Allows pulse-chase experiments with membrane-permeable fluorescent ligands

    Experimental approach: Generate transgenic zebrafish expressing opn1lw2-HaloTag fusion proteins. Pulse-label with cell-permeable JaneliaFluor dyes and track trafficking from inner segment to outer segment over time .

  • Correlative light and electron microscopy (CLEM):

    • Combines fluorescence localization with ultrastructural context

    • Reveals opsin association with specific membrane compartments

    • Can be enhanced with immunogold labeling for transmission EM

    Method: Fix transgenic zebrafish expressing fluorescent-tagged opn1lw2, image using confocal microscopy, then process for electron microscopy with registration between modalities.

  • Advanced functional imaging:

    • FRAP (Fluorescence Recovery After Photobleaching): Measures protein mobility and membrane dynamics

    • FRET (Förster Resonance Energy Transfer): Reveals protein-protein interactions with G-proteins or arrestins

    • Optogenetic tools: Can trigger opsin activation with precise spatiotemporal control

    Application example: FRAP experiments on opn1lw2-GFP in photoreceptor outer segments reveal diffusion rates and potential immobile fractions, providing insights into membrane organization and protein renewal.

Researchers have successfully used these techniques to demonstrate that fluorescent-tagged LWS2 fusion proteins localize specifically to the outer segments of photoreceptor cells, with fluorescence signals closely matching immunohistochemical detection using polyclonal antibodies against zebrafish red opsin . These advanced imaging approaches can further reveal the dynamics of opsin trafficking, which is essential for understanding photoreceptor function and maintenance.

How can studies of opn1lw2 inform our understanding of human color vision disorders?

Studies of zebrafish opn1lw2 provide valuable insights into human color vision disorders, particularly those affecting long-wavelength sensitive opsins:

  • Mechanistic parallels with human L/M opsin regulation:

    • Zebrafish LAR regulation of opn1lw1/opn1lw2 shares conceptual similarities with the locus control region (LCR) regulation of human L/M opsins

    • Both systems feature:
      a. Shared enhancer elements controlling multiple genes
      b. Competitive interactions between promoters and enhancers
      c. Position-dependent expression effects
      d. Similar transcription factor binding motifs

    This parallel provides a manipulable model system for understanding how regulatory mutations might affect human color vision gene expression .

  • Modeling specific human disorders:

    • Deuteranomaly/protanomaly (red-green color vision deficiency)

    • Blue cone monochromacy

    • X-linked cone dystrophy

    • Enhanced S-cone syndrome

    By introducing human mutation equivalents into zebrafish opn1lw2 using CRISPR-Cas9, researchers can study cellular and molecular consequences in vivo, including:

    • Effects on protein folding and stability

    • Subcellular localization and trafficking

    • Photoreceptor survival and connectivity

    • Visual behavior consequences

  • Therapeutic screening applications:

    • Test compounds that may correct folding or trafficking defects

    • Screen for molecules that might enhance function of remaining photoreceptors

    • Evaluate gene therapy approaches using vertebrate retinal circuitry

    The zebrafish model enables rapid screening of potential therapeutics in a vertebrate visual system with cone-dominant retina similar to human fovea.

  • Developmental insights:

    • Understanding the mechanisms of photoreceptor specification

    • Identifying factors controlling opsin expression ratios

    • Revealing how early developmental perturbations affect adult vision

Notably, zebrafish express their cone opsins in a distinct spatiotemporal pattern during development, with opn1lw2 expression beginning around 40 hpf and spreading throughout the retina by 72 hpf. This developmental regulation might provide insights into factors controlling the establishment of proper photoreceptor mosaics in humans. Moreover, the tail-to-head arrangement of zebrafish red opsin genes has similarities to the head-to-head arrangement of human L/M opsin genes, both featuring regulatory elements that enhance expression in specific photoreceptor types .

What computational models best predict the impact of amino acid substitutions on opn1lw2 spectral tuning?

Computational modeling of opsin spectral tuning has advanced significantly, with several approaches proving valuable for predicting the impact of amino acid substitutions on opn1lw2 absorption properties:

  • Quantum mechanical/molecular mechanical (QM/MM) hybrid models:

    • Most accurate approach for modeling spectral tuning

    • Treats chromophore and key interacting residues with quantum mechanics

    • Models protein environment with molecular mechanics

    • Key parameters:
      a. CASPT2 or TD-DFT for quantum region
      b. Appropriate force fields (AMBER, CHARMM) for protein environment
      c. Proper protonation state of Schiff base and counterion

  • Homology modeling with chromophore docking:

    • Based on available rhodopsin crystal structures (typically bovine rhodopsin or squid rhodopsin)

    • Sequence alignment critical for accurate model building

    • Energy minimization to optimize chromophore-protein interactions

    • Implementation:
      a. Generate structural model using MODELLER or SWISS-MODEL
      b. Dock 11-cis-retinal using AutoDock or similar tools
      c. Refine complex through energy minimization
      d. Analyze spectral tuning sites through computational mutagenesis

  • Machine learning approaches:

    • Train neural networks on existing opsin spectral data

    • Feature extraction from sequence alignments and structural information

    • Can accurately predict λmax shifts based on amino acid substitutions

    • Data requirements:
      a. Training set of >50 opsins with experimentally determined λmax values
      b. Sequence alignments with structural annotations
      c. Feature vectors incorporating physicochemical properties

  • Empirically-derived "five-sites" rule with refinements:

    • Based on site-directed mutagenesis studies across vertebrate visual opsins

    • Five key sites (180, 197, 277, 285, 308) account for majority of spectral tuning

    • Additional sites contribute smaller effects

    • Predictive accuracy:
      a. ±5-7 nm for single substitutions
      b. Increasing error with multiple substitutions due to non-additive effects
      c. Most reliable for closely related opsins

A comprehensive study comparing these methods found that QM/MM approaches achieve the highest accuracy (±3 nm) but require substantial computational resources. The empirically-derived five-sites rule provides a good first approximation (±7-10 nm) with minimal computation. Machine learning approaches are promising, with accuracy improving as training datasets expand .

For opn1lw2 specifically, the key spectral tuning sites identified across vertebrate LWS opsins apply well, with particular importance of the hydroxyl-bearing residues at positions 180, 277, and 285 that form hydrogen bonds with the chromophore. Substitutions at these positions can shift the absorption maximum by 5-15 nm per site.

How can single-cell transcriptomics reveal new insights into opn1lw2 expression and regulation?

Single-cell transcriptomics is revolutionizing our understanding of opsin gene expression and regulation, including opn1lw2, by providing unprecedented resolution of cell-specific expression patterns:

  • Identification of photoreceptor subtypes:

    • Single-cell RNA-seq reveals distinct clusters of photoreceptors

    • Transcriptional signatures associated with different opsin-expressing cells

    • Co-expression patterns of transcription factors governing cell fate decisions

    • Implementation strategy:
      a. Dissociate retinal cells from different regions/developmental stages
      b. Process using 10X Genomics or Smart-seq2 protocols
      c. Analyze using dimensionality reduction and clustering
      d. Identify marker genes for each cluster

  • Developmental trajectories of opsin expression:

    • Pseudotime analysis reveals sequence of gene activation events

    • Transition states between progenitor and differentiated photoreceptors

    • Regulatory cascades leading to opsin expression

    • Approach:
      a. Collect cells across multiple developmental timepoints (24 hpf to 5 dpf)
      b. Construct developmental trajectories using Monocle or similar algorithms
      c. Identify branch points representing cell fate decisions
      d. Map transcription factor dynamics preceding opsin expression

  • Spatial transcriptomics integration:

    • Combining single-cell data with spatial information

    • Mapping expression domains with cellular resolution

    • Correlating expression with retinal topography

    • Methods:
      a. Slide-seq or Visium spatial transcriptomics
      b. MERFISH or seqFISH for multiplexed RNA detection
      c. Registration with anatomical landmarks
      d. Integration with single-cell RNA-seq datasets

  • Chromatin accessibility and transcription factor binding:

    • Single-cell ATAC-seq reveals open chromatin regions

    • Identification of cis-regulatory elements active in opsin-expressing cells

    • Correlation with transcription factor expression

    • Protocol:
      a. Prepare single-cell suspensions from zebrafish retina
      b. Process using scATAC-seq protocols
      c. Identify differential accessibility regions
      d. Integrate with scRNA-seq and motif analysis

Recent single-cell studies have revealed that zebrafish retinal cells express opsins following a one-cell one-opsin regulation pattern in photoreceptors. Analysis of over 2,500 ommatidia from high-quality tissue sections showed that female R1 and R2 cells expressed on average 25.8% UV opsin, with approximately 75% expressing blue opsins (split between BRh1 at 62.7% and BRh2 at 11.5%). Males showed similar patterns with 28.4% UV photoreceptors, 63.3% BRh1, and 8.3% BRh2 photoreceptors .

These advanced single-cell approaches are uncovering complex regulatory networks controlling opn1lw2 expression and will likely reveal new factors involved in the spatial, temporal, and cell-type specific regulation of opsin genes.

What are the latest techniques for studying opn1lw2 protein-protein interactions in native cellular contexts?

Cutting-edge techniques for studying opn1lw2 protein-protein interactions in native cellular contexts include:

  • Proximity labeling approaches:

    • BioID/TurboID: Fusion of biotin ligase to opn1lw2 labels proximal proteins

    • APEX2: Peroxidase-based labeling with higher spatial and temporal resolution

    • Split-BioID: Allows detection of specific protein-protein interactions

    • Implementation strategy:
      a. Generate transgenic zebrafish expressing opn1lw2-TurboID fusion
      b. Administer biotin via water or injection
      c. Harvest retinal tissue at specific timepoints/conditions
      d. Purify biotinylated proteins and identify by mass spectrometry

  • Advanced fluorescence-based interaction detection:

    • FRET-FLIM: Measures fluorescence lifetime changes upon interaction

    • Split-fluorescent proteins: Complementation upon interaction (e.g., split-GFP, split-Venus)

    • BiFC: Bimolecular fluorescence complementation for visualizing interactions

    • Application example:
      a. Express opn1lw2-Venus-N and potential interactor-Venus-C
      b. Monitor fluorescence reconstitution in photoreceptor cells
      c. Quantify interaction dynamics during light adaptation

  • In situ protein interaction detection:

    • Proximity Ligation Assay (PLA): Detects native protein interactions with antibodies

    • CODEX: CO-Detection by indEXing for multiplexed protein detection

    • 4i: Iterative indirect immunofluorescence imaging

    • Method details:
      a. Fix retinal tissue using optimal preservation methods
      b. Perform proximity ligation with antibodies against opn1lw2 and candidate interactors
      c. Visualize interaction signals in cellular context
      d. Quantify regional differences in interaction patterns

  • Optogenetic interaction reporters:

    • OptoSOS/OptoDroplet: Light-induced protein clustering to probe interactions

    • LOVTRAP: Light-controlled protein dissociation to measure binding kinetics

    • PhotoActivatable Complementation: Light-induced protein fragment reassembly

    • Implementation:
      a. Express opn1lw2 fused to light-sensitive domains
      b. Apply spatially precise light stimulation
      c. Monitor interaction dynamics in real-time
      d. Quantify association/dissociation kinetics

These advanced techniques have revealed that opn1lw2 interacts with a network of proteins beyond the canonical G-protein signaling pathway. Recent studies using proximity labeling approaches identified interactions with trafficking machinery components, molecular chaperones, and cytoskeletal elements that participate in outer segment maintenance and renewal .

The application of these techniques in zebrafish photoreceptors is particularly valuable given the cellular diversity and complex spatial organization of the retina, allowing protein-protein interactions to be studied in their native cellular environment rather than artificial expression systems.

What are the key reagents and genetic tools available for studying opn1lw2 in zebrafish?

The following key reagents and genetic tools are available for studying opn1lw2 in zebrafish:

  • Antibodies and immunological tools:

    • Polyclonal antibody against zebrafish red opsin (recognizes both LWS-1 and LWS-2)

    • Custom monoclonal antibodies against unique epitopes of LWS-1 vs. LWS-2

    • Fluorescently labeled secondary antibodies optimized for zebrafish tissue

  • Transgenic reporter lines:

    • Tg(LWS-2:GFP) - GFP expression under control of opn1lw2 promoter

    • Tg(LWS-PAC) - P1-artificial chromosome clone containing both red opsin genes with reporters

    • Tg(LWS2-K) - Transgenic line expressing LWS2-K fusion protein

  • Mutant lines:

    • CRISPR/Cas9-generated opn1lw2 knockout lines

    • Point mutation lines affecting spectral tuning

    • Regulatory element deletion lines (e.g., LAR deletion)

    • Lines with altered gene order or spacing

  • Expression constructs:

    • Plasmids containing opn1lw2 coding sequence optimized for various expression systems

    • Constructs with different promoters for tissue-specific expression

    • Fluorescent protein fusion constructs for tracking protein localization

    • BiFC constructs for protein interaction studies

  • cDNA probes for in situ hybridization:

    • Digoxigenin-labeled antisense riboprobes specific for opn1lw2

    • Discriminatory probes targeting unique regions of opn1lw1 vs. opn1lw2

    • Multiplex FISH probe sets for simultaneous detection of multiple opsins

  • Genomic resources:

    • BAC/PAC clones containing the complete opn1lw locus

    • Annotated genomic sequence with regulatory elements identified

    • ChIP-seq data for retinal transcription factors binding in the opn1lw locus

    • Sequence variants identified across zebrafish strains

  • Purified proteins:

    • Recombinant LWS-2 opsin expressed in mammalian cells

    • Purified 11-cis-retinal for reconstitution studies

    • G-protein subunits for in vitro functional assays

These resources have been developed and validated by multiple research groups, facilitating the study of opn1lw2 at genetic, cellular, and biochemical levels. The availability of transgenic lines that recapitulate native expression patterns is particularly valuable for understanding the spatio-temporal regulation of opn1lw2 .

What standardized protocols exist for studying opsin expression and function in zebrafish?

Standardized protocols for studying opsin expression and function in zebrafish have been developed and refined by the research community:

  • Retinal tissue preparation techniques:

    • Cryosectioning protocol:
      a. Fix larvae in 4% paraformaldehyde overnight at 4°C
      b. Cryoprotect in 30% sucrose/PBS
      c. Orient and embed in OCT compound
      d. Section at 10-12 μm thickness
      e. Store sections at -80°C until use

    • Whole-mount preparation:
      a. Fix embryos/larvae in 4% paraformaldehyde
      b. Remove yolk sac and permeabilize with 0.5% Triton X-100
      c. For older larvae (>5 dpf), remove lens to improve antibody penetration
      d. Block in 5% normal goat serum with 0.3% Triton X-100

  • Expression analysis methods:

    • In situ hybridization protocol:
      a. Generate riboprobes from opsin cDNA templates
      b. Hybridize at 65°C overnight
      c. Detect using anti-DIG antibodies or fluorescent detection systems
      d. Include positive controls (known expressed genes) and negative controls

    • Quantitative RT-PCR:
      a. Dissect retinal tissue or collect whole eyes
      b. Extract RNA using TRIzol or RNeasy kits
      c. Perform reverse transcription with oligo(dT) primers
      d. Design primers spanning exon-exon junctions for specificity
      e. Normalize expression to reference genes (ef1α, β-actin)

  • Transgenic reporter methods:

    • Microinjection procedure:
      a. Prepare DNA at 25-50 ng/μl in injection buffer
      b. Co-inject with Tol2 transposase mRNA (25 ng/μl)
      c. Inject 1-2 nl into one-cell stage embryos
      d. Sort for GFP-positive embryos at 24-48 hpf

    • Screening protocol:
      a. Raise injected fish to adulthood
      b. Outcross to wildtype and screen F1 progeny for fluorescence
      c. Establish stable lines from positive founders
      d. Characterize expression patterns using confocal microscopy

  • Functional analysis protocols:

    • Electroretinogram (ERG) recording:
      a. Dark-adapt fish for at least 1 hour
      b. Anesthetize with tricaine
      c. Place fish in recording chamber with aerated water
      d. Position recording electrode on cornea
      e. Deliver light stimuli of defined wavelength, intensity, and duration
      f. Record responses to red (650 nm) stimuli to assess LWS function

    • Behavioral visual assays: a. Optokinetic response (OKR): present rotating stripes of specific wavelengths b. Optomotor response (OMR): present moving gratings below swimming fish c. Visual startle response: present sudden changes in illumination d. Phototaxis: assess movement toward or away from specific wavelengths of light

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.