Recombinant Danio rerio Reprimo-like protein (rprml)

Shipped with Ice Packs
In Stock

Description

Introduction to Reprimo-Like Protein

The Reprimo gene family comprises a group of highly conserved single-exon genes whose physiological functions remain incompletely understood. Reprimo-like protein (rprml) is a specific member of this family expressed in zebrafish (Danio rerio) . While its homolog Reprimo (RPRM) has been characterized as a p53-dependent tumor suppressor involved in G2/M cell cycle checkpoint regulation, the functional role of rprml has only recently begun to be elucidated . Importantly, research demonstrates that rprml expression patterns show evolutionary conservation between zebrafish and human species, suggesting fundamental biological significance across vertebrates .

Molecular Structure and Characteristics

Reprimo-like protein is characterized by specific molecular identifiers and structural properties that define its biological capabilities:

Basic Molecular Properties

Recombinant Danio rerio Reprimo-like protein is identified by the UniProt accession number A5PLA0 . The protein is produced through baculovirus expression systems to yield a partially purified product with greater than 85% purity as verified by SDS-PAGE analysis . The gene encoding this protein (rprmL) is alternatively designated by the ORF name zgc:165459 .

Biological Functions of rprml

Research has revealed several important biological functions of rprml, with its most well-characterized role being in hematopoietic development:

Essential Role in Definitive Hematopoiesis

One of the most significant discoveries regarding rprml is its requirement for proper blood development in embryonic zebrafish. Studies using CRISPR-Cas9 and antisense morpholino oligonucleotides to disrupt rprml expression have demonstrated that its loss leads to impaired definitive hematopoiesis . Specifically:

  • The primitive wave of hematopoiesis and formation of hemangioblasts occur normally even in the absence of rprml

  • Later developmental stages show a significant reduction in erythroid-myeloid precursors (EMP) at the posterior blood island (PBI) when rprml is disrupted

  • A significant decline in definitive hematopoietic stem/progenitor cells (HSPCs) is observed in rprml-deficient embryos

  • Loss of rprml increases caspase-3 activity in endothelial cells within the caudal hematopoietic tissue (CHT), which serves as the first perivascular niche where HSPCs reside during zebrafish embryonic development

Table 1: Effects of rprml Disruption on Zebrafish Hematopoiesis

Hematopoietic ProcessEffect of rprml DisruptionDevelopmental Stage
Primitive HematopoiesisNo significant effectEarly somitic stages
Hemangioblast FormationNormalEarly development
Erythroid-Myeloid PrecursorsSignificant reduction at PBILater development
Definitive HSPCsSignificant declineLater development
Endothelial Cell ViabilityIncreased caspase-3 activityCHT formation stage

Expression in Nervous System Development

Beyond its hematopoietic functions, rprml shows specific expression patterns in the developing nervous system of zebrafish:

  • rprml is primarily expressed in the telencephalon (Tel) during embryonic development

  • This expression pattern differs from other Reprimo family members (rprma and rprmb), which are expressed in different neuronal structures

  • The expression domains appear to be conserved between teleosts and mammals, suggesting evolutionarily preserved functions in neural development

Potential Tumor Suppressor Activity

Similar to its mammalian homolog RPRM, there is evidence suggesting that rprml may function as a tumor suppressor:

Evidence from Human Studies

In humans, RPRML protein expression has been detected in the cytoplasm of glandular and foveolar epithelial cells of the stomach . Multiple analyses of gastric tumors have revealed that RPRML expression is significantly downregulated compared to normal adjacent tissues . This loss of expression correlates with reduced levels of the apoptotic marker cleaved caspase-3 and is associated with worse prognosis in patients with advanced stages of gastric cancer .

Functional Evidence

Experimental studies have demonstrated that RPRML overexpression in gastric cancer cell lines inhibits cell cycle progression at the G2/M phase, reduces cell proliferation, diminishes clonogenic capacity, and suppresses anchorage-independent growth . In colorectal cancer cells, RPRML has been identified as a target of the Wnt/β-catenin signaling pathway . Furthermore, like its homolog RPRM, the silencing of RPRML in gastric cancer appears to be mediated by DNA methylation, and circulating methylated RPRML DNA in plasma samples has shown promise as a potential non-invasive biomarker for gastric cancer diagnosis .

Comparison with Other Reprimo Family Members

The Reprimo gene family in zebrafish includes three members with distinct expression patterns and potential functions:

Table 2: Expression Patterns of Reprimo Family Members in Zebrafish

GenePrimary Expression LocationFunction
rprmaOlfactory placodes (OP) and olfactory epithelium (OE)Not fully characterized
rprmbTectum opticum (TeO) and trigeminal ganglion (Tg)Not fully characterized
rprmlTelencephalon (Tel)Required for definitive hematopoiesis

This differential expression suggests specialized roles for each family member in distinct developmental processes and anatomical structures . Despite these differences, the expression domains appear conserved between teleosts and mammals, indicating evolutionarily preserved functions .

Production and Purification

The recombinant protein is typically produced using baculovirus expression systems and purified to greater than 85% purity as determined by SDS-PAGE analysis . The protein may contain specific tags to facilitate detection and purification, with the exact tag type determined during the manufacturing process .

Research Applications and Methods

Recombinant Danio rerio Reprimo-like protein has been employed in various research applications utilizing different methodological approaches:

Genetic Manipulation Studies

The function of rprml has been investigated through gene disruption techniques including CRISPR-Cas9 genome editing and antisense morpholino oligonucleotide knockdown . These approaches have been instrumental in revealing the protein's role in definitive hematopoiesis.

Expression Analysis

The expression pattern of rprml has been studied using multiple techniques:

  • Whole-mount in situ hybridization (WISH) for transcript detection

  • Immunohistochemistry/immunofluorescence (IHC/IF) for protein localization

  • RNA-Seq for transcriptomic analysis, such as that performed in studies of zebrafish eosinophils with differential genotypes

Conservation Studies

Comparative analyses of rprml expression and function between zebrafish and mammalian models have demonstrated evolutionary conservation of this gene family, supporting its fundamental biological importance .

Future Research Directions

Given the emerging understanding of rprml's biological significance, several promising research directions warrant further investigation:

Molecular Mechanisms

Further elucidation of the precise molecular pathways through which rprml influences definitive hematopoiesis could provide valuable insights into fundamental developmental processes. Understanding how rprml affects endothelial cell survival in the caudal hematopoietic tissue might reveal important mechanisms in the regulation of hematopoietic stem cell niches.

Therapeutic Potential

The apparent tumor suppressor activity of RPRML in human cancers suggests potential therapeutic applications. Further investigation into how RPRML inhibits cell cycle progression and whether its reactivation could suppress tumor growth may yield novel cancer treatment strategies.

Diagnostic Applications

The observation that circulating methylated RPRML DNA may serve as a biomarker for gastric cancer diagnosis warrants further exploration for the development of non-invasive diagnostic tools .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
rprml; zgc:165459; Reprimo-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
rprml
Target Protein Sequence
MNGTFFNHTVFTHGVLLNRSQELAGTLVDCCTGNGSEVTANDGGGSLVLAQDERKLFVTR VVQIAVLCVLSLTVMFGIFFLGCNLMIKSESMINFLVKDRRSSKDVEAVMIGLS
Uniprot No.

Target Background

Database Links

KEGG: dre:100073335

UniGene: Dr.114261

Protein Families
Reprimo family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the Reprimo gene family and how is rprml classified within it?

The Reprimo gene family comprises a group of single-exon genes whose physiological functions remain poorly understood. In zebrafish, this family includes rprma, rprmb (duplicated forms of RPRM), rprml (Reprimo-like), and rprm3. Mammalian Reprimo (RPRM) has been characterized as a putative p53-dependent tumor suppressor gene functioning at the G2/M cell cycle checkpoint. Reprimo-like (RPRML) is a distinct family member with emerging roles in developmental processes, particularly hematopoiesis .

What is the expression pattern of rprml during zebrafish development?

In zebrafish, rprml shows a specific spatiotemporal expression pattern during development. RT-qPCR analysis reveals that rprml is expressed at low levels starting from early developmental stages (0.75-96 hours post-fertilization). At 12 hours post-fertilization (hpf), rprml expression is lower than rprmb but shares a similar ascending trend toward 4 days post-fertilization (dpf). Whole-mount in situ hybridization (WISH) demonstrates that rprml is primarily expressed in the telencephalon (Tel) and notochord at 24 hpf, while lacking staining in somites during early somitogenesis .

How does rprml function differ from other Reprimo family members in zebrafish?

Each Reprimo gene in zebrafish (rprma, rprmb, and rprml) displays distinct expression patterns during neural development, suggesting subfunctionalization. While rprma is primarily expressed in the olfactory placodes (OP) and olfactory epithelium (OE), and rprmb is observed in the tectum opticum (TeO) and trigeminal ganglion (Tg), rprml is predominantly found in the telencephalon. This distinct localization indicates specific roles for each gene during nervous system development. Additionally, rprml has a demonstrated role in definitive hematopoiesis not documented for other family members .

What mechanisms underlie rprml's role in definitive hematopoiesis in zebrafish?

Studies using CRISPR-Cas9 and antisense morpholino oligonucleotides to disrupt rprml expression have demonstrated that its loss leads to impaired definitive hematopoiesis in zebrafish. While the formation of hemangioblasts and the primitive wave of hematopoiesis proceed normally without rprml, later developmental stages show significant reduction in erythroid-myeloid precursors (EMP) at the posterior blood island (PBI) and a decline in definitive hematopoietic stem/progenitor cells (HSPCs). Furthermore, rprml loss increases caspase-3 activity in endothelial cells within the caudal hematopoietic tissue (CHT), the first perivascular niche where HSPCs reside during zebrafish embryonic development. This suggests rprml may regulate apoptotic processes in the hematopoietic niche, potentially through interaction with apoptotic pathways .

How is evolutionary conservation of rprml expression manifested across vertebrate species?

The expression pattern of RPRM/rprml shows remarkable conservation between teleosts and mammals, particularly in the nervous system. In both zebrafish (at 72 hpf) and mice (at E15.5, a developmentally equivalent stage), RPRM is expressed in the olfactory epithelium. In mice, RPRM mRNA is clearly expressed in the OE, and transgenic mice expressing EGFP under the control of RPRM cis-regulatory modules show strong signals in the midbrain and OE, with weaker signals in the olfactory bulb. This conservation suggests that RPRM/rprml likely plays fundamental roles in vertebrate neural development that have been maintained throughout evolutionary history .

What is the relationship between rprml and DNA damage response pathways?

While direct evidence for rprml's role in DNA damage response is limited, related family member RPRM has been implicated in DNA damage repair processes. RPRM can be induced by DNA damage and plays an important role in DNA damage repair and cellular radiosensitivity through negative regulation of ataxia-telangiectasia-mutated (ATM) protein kinase. In RPRM knockout mouse models, DNA damage levels (as measured by γ-H2AX) were significantly reduced following radiation exposure compared to wild-type mice. This suggests potential involvement of the Reprimo family in DNA damage response pathways, though specific mechanisms for rprml would require further investigation .

What are the optimal methods for manipulating rprml expression in zebrafish models?

Research demonstrates that effective manipulation of rprml expression in zebrafish can be achieved through two primary approaches:

  • CRISPR-Cas9 gene editing: This technique enables precise genomic disruption of rprml and has been successfully employed to generate knockout models that revealed rprml's role in definitive hematopoiesis.

  • Antisense morpholino oligonucleotides: These can be designed to block rprml translation or splicing, providing a complementary approach to CRISPR for transient knockdown.

When designing experiments, researchers should consider:

  • Including appropriate controls (e.g., scrambled morpholinos or CRISPR with non-targeting gRNAs)

  • Validating knockdown/knockout efficiency using RT-qPCR and/or Western blotting

  • Assessing potential off-target effects

  • Determining optimal developmental timepoints for analysis based on rprml's expression pattern (particularly focusing on 24-96 hpf when expression increases) .

What controls and experimental conditions are critical when studying rprml in gene expression studies?

When designing gene expression studies for rprml, several critical factors should be considered:

  • Reference genes: Select stable reference genes for RT-qPCR normalization that do not fluctuate under the experimental conditions.

  • Developmental staging: Precise staging is crucial since rprml expression changes throughout development, with an ascending trend toward 4 dpf.

  • Tissue specificity: Given rprml's confined expression in specific neural structures (primarily telencephalon), tissue-specific analysis may be required rather than whole-embryo assessment.

  • Replicates: Include both biological replicates (different embryos) and technical replicates to account for biological variation and technical errors.

  • Environmental controls: Maintain consistent temperature, light cycles, and water quality as these factors may influence gene expression.

  • Treatment conditions: When applying experimental interventions, carefully define treatment doses, durations, and administration methods.

These controls help minimize variability and ensure reliable, reproducible results in rprml expression studies .

What techniques are most effective for visualizing rprml expression patterns in zebrafish?

Based on published research, several complementary techniques have proven effective for visualizing rprml expression:

  • Whole-mount in situ hybridization (WISH): This technique effectively reveals spatial expression patterns of rprml mRNA in intact zebrafish embryos at various developmental stages. Gene-specific complementary RNA probes can be designed to target rprml transcripts.

  • RT-qPCR: For quantitative temporal expression analysis, RT-qPCR provides precise measurements of rprml transcript levels across developmental timepoints (0.75-96 hpf).

  • Immunohistochemistry/Immunofluorescence (IHC/IF): These techniques can detect RPRM protein localization in specific tissues, as demonstrated in studies of the zebrafish nervous system.

  • Transgenic reporter lines: Though not explicitly mentioned for rprml in zebrafish, transgenic approaches (similar to the TG(BAC-180MB-RPRM-EGFP) mouse line) that express fluorescent proteins under rprml regulatory elements could provide dynamic visualization of expression patterns.

For optimal results, researchers should combine these approaches to correlate transcript and protein localization data .

How can researchers accurately assess the functional consequences of rprml manipulation in hematopoiesis?

To accurately assess functional consequences of rprml manipulation on hematopoiesis, researchers should implement a multi-parameter approach:

  • Quantification of hematopoietic populations:

    • Assess erythroid-myeloid precursors (EMP) at the posterior blood island (PBI)

    • Evaluate definitive hematopoietic stem/progenitor cells (HSPCs) using appropriate markers

    • Analyze cells within the caudal hematopoietic tissue (CHT)

  • Molecular markers analysis:

    • Use transgenic reporter lines that mark specific hematopoietic lineages

    • Perform WISH or immunostaining for hematopoietic markers

    • Conduct flow cytometry to quantify specific cell populations

  • Functional assays:

    • Measure caspase-3 activity in endothelial cells of the CHT

    • Evaluate blood cell production and circulation

    • Assess hematopoietic recovery following challenges

  • Temporal considerations:

    • Distinguish between effects on primitive versus definitive hematopoiesis

    • Examine multiple developmental timepoints (particularly focusing on later stages when definitive hematopoiesis occurs)

This comprehensive approach enables reliable detection of hematopoietic defects resulting from rprml manipulation .

How should researchers address potential compensatory mechanisms when studying rprml knockdown/knockout?

When studying rprml knockdown or knockout models, researchers should systematically address potential compensatory mechanisms:

  • Examine expression of other Reprimo family members:

    • Quantify expression levels of rprma and rprmb following rprml disruption

    • Determine whether their expression patterns change spatially in response to rprml loss

  • Implement both acute and chronic loss-of-function models:

    • Compare morpholino-mediated knockdown (acute) with CRISPR-Cas9 knockout (chronic) phenotypes

    • Differences between these approaches may reveal compensatory mechanisms that develop over time

  • Conduct time-course analyses:

    • Examine gene expression and phenotypic changes at multiple timepoints

    • Early timepoints may reveal primary effects before compensation occurs

  • Perform rescue experiments:

    • Test whether phenotypes can be rescued by expressing rprml or other family members

    • Partial rescue by other Reprimo genes would suggest functional redundancy

  • Apply pathway analysis:

    • Investigate whether alternate pathways become activated following rprml loss

    • Focus particularly on p53-dependent pathways given RPRM's known connection to p53

This systematic approach helps distinguish direct rprml functions from compensatory adaptations in knockout/knockdown models .

What statistical approaches are most appropriate for analyzing changes in rprml expression across developmental timepoints?

When analyzing changes in rprml expression across developmental timepoints, researchers should consider these statistical approaches:

  • For temporal expression data:

    • Repeated measures ANOVA or mixed-effects models to account for measurements from the same cohort across timepoints

    • Time-series analysis to identify patterns and trends in expression over developmental stages

    • Regression analysis to model expression changes as a function of developmental time

  • For comparing expression across tissues or conditions:

    • Two-way ANOVA to evaluate effects of both developmental stage and tissue type

    • Post-hoc tests (e.g., Tukey's HSD) for pairwise comparisons between specific timepoints

    • Bonferroni or other multiple-testing corrections when performing numerous comparisons

  • For expression correlation analysis:

    • Pearson or Spearman correlation to assess relationships between rprml and other genes

    • Principal component analysis to identify major sources of variation in multi-gene datasets

    • Hierarchical clustering to identify genes with similar expression patterns to rprml

  • For visualizing temporal data:

    • Box plots showing distribution of expression at each timepoint

    • Line graphs with error bars to display trends over time

    • Heat maps for comparing expression across multiple genes and timepoints

These approaches should be selected based on experimental design, data distribution, and specific research questions .

How does the function of rprml in zebrafish compare to its orthologs in mammalian systems?

The function of rprml in zebrafish compared to its mammalian orthologs reveals both conserved and divergent aspects:

Conserved elements:

  • Expression patterns: RPRM/rprml expression is notably conserved between zebrafish and mice, particularly in the olfactory system. At equivalent developmental stages (zebrafish at 72 hpf, mouse at E15.5), RPRM is expressed in the olfactory epithelium in both species.

  • Neural expression: Both zebrafish rprml and mouse RPRM show specific expression in defined regions of the developing central nervous system, suggesting conserved roles in neural development.

Potential differences:

  • Gene duplication: In zebrafish, the RPRM gene has duplicated to form rprma and rprmb, whereas mammals have a single RPRM gene, potentially allowing for subfunctionalization in fish.

  • Hematopoietic roles: While zebrafish rprml has a documented role in definitive hematopoiesis, this specific function has not been extensively characterized for mammalian RPRML.

  • Tumor suppression: Mammalian RPRM has been well-characterized as a p53-dependent tumor suppressor gene functioning at the G2/M cell cycle checkpoint, whereas the tumor suppressor function of zebrafish rprml requires further investigation.

This evolutionary comparison suggests that while core functions in neural development may be conserved, some specialized functions may have evolved differently between species .

What insights can cross-species analysis of rprml provide about its fundamental biological functions?

Cross-species analysis of rprml/RPRML provides several key insights into its fundamental biological functions:

  • Evolutionary conservation indicates essential roles:

    • The conservation of RPRML expression patterns between teleosts and mammals suggests it performs critical functions maintained under evolutionary pressure

    • This conservation is particularly evident in the nervous system, where both zebrafish and mouse express RPRM/RPRML in the olfactory epithelium

  • Context-dependent subfunctionalization:

    • In zebrafish, three Reprimo genes (rprma, rprmb, and rprml) show distinct expression patterns in different regions of the embryonic nervous system

    • This suggests evolutionary subfunctionalization, with each gene potentially specializing in different neural tissues

  • Developmental timing conservation:

    • The expression of RPRM/RPRML at equivalent developmental stages across species (zebrafish at 72 hpf, mouse at E15.5) indicates conserved roles during specific developmental windows

  • Potential core functions:

    • The expression of RPRM/RPRML in sensory structures across species suggests fundamental roles in sensory system development

    • Conservation in neural tissues may indicate essential functions in neurogenesis, neural patterning, or neuronal differentiation

Cross-species analyses thus reveal that while some functions may have diverged, RPRM/RPRML likely plays fundamental roles in vertebrate neural development, particularly in sensory systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.