Recombinant Danio rerio Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
rho; zfo2; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
rho
Target Protein Sequence
MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGLLAAYMFFLIITGFPVNFLTLY VTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLG GEMGLWSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIP EGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAV YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish employ 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Gene References Into Functions
  1. The efficiency of CRISPR/Cas9 for gene targeting, coupled with the extensive mutations associated with retinitis pigmentosa, facilitated the rapid isolation of novel alleles in zebrafish that phenocopy the disease. PMID: 30210230
  2. Overexpression of full-length rhodopsin or its cytoplasmic tail domain, but not of rhodopsin lacking the cytoplasmic tail, exacerbated rod degeneration in kif3a mutants, indicating a significant role of the cytoplasmic tail in rod degeneration. PMID: 28855254
  3. The expression and protein localization of rhodopsin in zebrafish from larval to adult stages were demonstrated. These findings indicate the involvement of rhodopsin in the physiology of the zebrafish pineal gland, particularly in light capture throughout the lifespan of the zebrafish. PMID: 22306032
  4. Mitogen-associated protein kinase and protein kinase A regulate rhodopsin transcription through parallel signal transduction pathways. PMID: 17183589
Database Links

KEGG: dre:30295

STRING: 7955.ENSDARP00000011562

UniGene: Dr.354

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Tissue Specificity
Retinal rod photoreceptor cells, predominantly in the outer segments (at protein level). Retinal rod photoreceptor cells.

Q&A

What is Danio rerio Rhodopsin and how does it differ from other vertebrate rhodopsins?

The canonical rhodopsin (rh1) is highly conserved, but zebrafish also possess a second rhodopsin-like gene (rh1-2) that is not a tandem duplicate of rh1, as these genes are located on chromosomes 11 and 8, respectively . This rh1-2 variant can bind chromophore and activate in response to light, producing an absorption spectrum with λmax around 500 nm, but shows a different developmental expression pattern than rh1 . While rh1 is expressed during early embryonic development, rh1-2 is not expressed during the first 4 days post-fertilization and appears only in the retina of adult fish, not in brain or muscle tissue .

What are the characteristics of recombinant Danio rerio Rhodopsin protein preparations?

Recombinant Full-Length Danio rerio Rhodopsin protein (P35359) typically spans amino acids 1-354 and can be successfully expressed in E. coli expression systems . Common preparations include N-terminal His-tagged versions to facilitate purification . The purified protein is often supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

The amino acid sequence of zebrafish rhodopsin contains the characteristic seven transmembrane domains of GPCRs with highly conserved regions necessary for proper folding and function . For storage and handling, it is typically recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers optimize heterologous expression of Danio rerio Rhodopsin?

When expressing zebrafish rhodopsin in heterologous systems, researchers should consider:

  • Expression System Selection: While E. coli systems can produce the protein (as seen in commercial preparations) , mammalian expression systems like HEK293T cells offer advantages for studying functional aspects of rhodopsin. HEK293 cells are regarded as viable substitutes for studying mammalian opsin function and transport, allowing rapid evaluation of numerous mutants .

  • Vector Design: Adding fusion tags (like EGFP) can facilitate visualization of trafficking and proper folding. As demonstrated with bovine rhodopsin (bRho-EGFP), which shares 82% sequence similarity with many vertebrate rhodopsins, fluorescent protein fusions can be used to track cellular localization .

  • Promoter Selection: Strong promoters like the cytomegalovirus (CMV) promoter are commonly used for robust expression in mammalian systems .

  • Temperature Considerations: Zebrafish are typically maintained at 26°C, which differs from mammalian culture conditions. For optimal folding of zebrafish proteins, temperature adjustments during expression might be necessary .

  • Reconstitution with Chromophore: For functional studies, the protein must be properly reconstituted with 11-cis-retinal to form the functional photopigment.

What methods are most effective for purifying recombinant zebrafish rhodopsin?

For purification of His-tagged zebrafish rhodopsin:

  • Immobilized Metal Affinity Chromatography (IMAC): Use Ni-NTA resin for initial capture of His-tagged protein.

  • Detergent Selection: Critical for maintaining proper folding of this membrane protein. Common detergents include n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG).

  • Buffer Optimization: Tris/PBS-based buffers (pH 8.0) with stabilizing agents like trehalose (6%) are effective for maintaining protein stability .

  • Size Exclusion Chromatography: Often used as a polishing step to remove aggregates and improve purity to >90% as verified by SDS-PAGE .

  • Quality Control: UV-Vis spectroscopy can confirm proper folding and chromophore binding by analyzing the characteristic absorption spectrum around 500 nm .

How do zebrafish recoverin isoforms interact with rhodopsin kinases and affect rhodopsin function?

Zebrafish express multiple recoverin isoforms that regulate rhodopsin kinases in a calcium-dependent manner. The zebrafish retina expresses four recoverin genes: rcv1a, rcv1b, rcv2a, and rcv2b, coding for proteins zRec1a, zRec1b, zRec2a, and zRec2b respectively . These recoverin isoforms demonstrate different expression patterns:

  • zRec1a is found only in rods and UV cones

  • zRec1b, zRec2a, and zRec2b are present in all cone photoreceptors

  • zRec2a is also expressed in bipolar cells

Functionally, recoverin inhibits G protein-coupled receptor kinase GRK1 (rhodopsin kinase) at high levels of free Ca²⁺ . The specific pairings between recoverin isoforms and kinases in zebrafish appear to be:

  • GRK1a-Rec1a (primarily in rods)

  • GRK7a-Rec2a (primarily in UV cones)

  • Regulation of GRK1b and GRK7b by Rec2b is also possible

Flash response data indicates that zRec2a and zRec2b operate under different light regimes, suggesting different Ca²⁺-sensitive properties . These differences in recoverin isoforms and their interactions with rhodopsin kinases contribute to the diverse light sensitivity and adaptation mechanisms in zebrafish photoreceptors.

What role does the hydrophobic interaction between TM1 and H8 play in rhodopsin transport?

The hydrophobic interaction between transmembrane helix 1 (TM1) and helix 8 (H8) is critical for efficient rhodopsin transport to the vertebrate photoreceptor ciliary outer segment . This interaction appears to be evolutionarily conserved across vertebrate rhodopsins.

In bovine rhodopsin (bRho), which shares 82% sequence similarity with other vertebrate rhodopsins, H8 and TM1 are highly conserved, except for an inversion of leucine (L) and methionine (M) at positions 317 and 57 . Studies using bRho fused with EGFP and expressed in HEK293T cells have shown that disruption of this hydrophobic interaction results in reduced efficiency of plasma membrane delivery .

For researchers working with zebrafish rhodopsin, consideration of these structural features is important when designing mutations for functional studies. Complementary mutations that preserve the hydrophobic nature of the interaction might be necessary to maintain proper trafficking of the recombinant protein.

How can rhodopsin knockout models in zebrafish be effectively utilized in vision research?

Zebrafish rhodopsin knockout models provide valuable insights into rhodopsin function and retinal degeneration. Several approaches can be implemented:

  • Morpholino-Based Knockdown: This approach has been used to study the in vivo function of zebrafish recoverin proteins that regulate rhodopsin kinases . This method allows for temporal control of gene knockdown.

  • CRISPR-Cas9 Gene Editing: Creates stable knockout lines for long-term studies.

  • Analysis Methods:

    • Electroretinography (ERG): Both normal and spectral ERG can be used to assess retinal function in knockout models. Studies of rlbp1a knockout zebrafish (which affects rhodopsin regeneration) showed diminished ERG responses under various light conditions with sensitivity shifted approximately one log unit and maximum amplitude remaining below wild-type levels .

    • Histological Analysis: Can reveal structural changes in retina. In rlbp1a knockout larvae at 5 days post-fertilization, fewer rod outer segments were observed in the ventral retinal periphery, indicating either slower development or early loss of rod outer segments .

    • mRNA Expression Analysis: Quantifies rhodopsin expression changes. Analysis of rhodopsin mRNA expression in rlbp1a knockout zebrafish revealed lower expression at 5 dpf and in adults .

    • Retinoid Analysis: High-performance liquid chromatography (HPLC) can be used to analyze retinoid content, including 11-cis-retinal levels which directly impact rhodopsin function .

How does the loss of rlbp1a affect rhodopsin expression and photoreceptor function in zebrafish?

The rlbp1a gene in zebrafish encodes cellular retinaldehyde-binding protein (CRALBP), which plays a crucial role in the visual cycle. Knockout of rlbp1a affects rhodopsin in several ways:

  • Reduced Rhodopsin Expression: Analysis of rhodopsin mRNA expression revealed lower expression at 5 days post-fertilization (dpf) and in adult rlbp1a knockout zebrafish. In adult rlbp1a−/− single knockout fish, the reduction was approximately fourfold, while in double knockout fish (rlbp1a−/− and rlbp1b−/−), the reduction was roughly twofold .

  • Retinoid Metabolism Disruption: Eyes of rlbp1a−/− larvae showed a steep decline of 11-cis-retinal (11cisRAL, the rhodopsin chromophore) under ambient illumination compared to controls. After bleaching with blue light and redark adaptation, these larvae regenerated 11cisRAL to only 57% of the level observed in dark-adapted larvae .

  • Morphological Changes: Histological examination of rlbp1a−/− larvae at 5 dpf showed fewer rod outer segments in the ventral retinal periphery. By 34 dpf, the outer segments of both rods and cones were severely shortened, dysmorphic, or sometimes completely absent .

  • Functional Impact: Electroretinography (ERG) responses of rlbp1a−/− zebrafish were diminished under all light conditions when compared to wild types. The sensitivity was shifted approximately one log unit, and the maximum amplitude remained below wild-type levels in all illumination conditions examined .

These findings indicate that proper rhodopsin function depends significantly on RPE-expressed Cralbpa (encoded by rlbp1a) in zebrafish, highlighting the importance of the visual cycle for maintaining photoreceptor health and function.

How do the multiple rhodopsin genes in zebrafish differ in their expression patterns and functional properties?

Zebrafish possess multiple rhodopsin genes with distinct expression patterns and functional properties:

  • Canonical Rhodopsin (rh1): Expressed during early embryonic development and functions as the primary visual pigment in rod photoreceptors .

  • Rhodopsin-like gene (rh1-2):

    • Not expressed during the first 4 days of embryonic development

    • Expressed in the retina of adult fish but not in brain or muscle

    • Not a tandem duplicate of rh1 (located on chromosome 11, whereas rh1 is on chromosome 8)

    • When expressed in vitro, it binds chromophore, producing an absorption spectrum in the visible range (λmax ~500 nm) and activates in response to light

    • Similar rh1-2 sequences are found in other Danio species and in the more distantly related cyprinid, Epalzeorhynchos bicolor

  • Exorhodopsin: A non-visual opsin that is a paralog to mammalian Rh1 genes, sharing 70% sequence similarity. Unlike other non-visual opsins which share only 25-32% similarity with visual opsins, exorhodopsin is more closely related to visual rhodopsin .

This diversity of rhodopsin genes in zebrafish makes them an excellent model for studying the evolution and specialization of visual pigments. Researchers interested in recombinant expression should carefully consider which rhodopsin variant to use based on their specific research questions.

What experimental approaches can resolve contradictory data regarding rhodopsin function across different zebrafish mutant models?

When facing contradictory data regarding rhodopsin function across different zebrafish mutant models, researchers can employ several methodological approaches:

  • Comprehensive Genetic Analysis:

    • Generate and analyze both single and double knockouts to identify compensatory mechanisms. For example, studies of rlbp1a and rlbp1b knockouts revealed that double-knockout fish largely recapitulated the findings in rlbp1a−/− fish, but with some notable differences such as slightly better preservation of rod outer segments in adults .

    • Use genotyping to ensure genetic background consistency across experimental groups.

  • Multi-timepoint Analysis:

    • Examine phenotypes at multiple developmental stages. Rhodopsin expression and photoreceptor morphology can differ significantly between larval (5 dpf), juvenile (34 dpf), and adult stages .

    • Track progression of phenotypes longitudinally when possible.

  • Multi-parametric Functional Assessment:

    • Combine electroretinography (ERG) under various light conditions (dark-adapted, light-adapted, post-bleach) to comprehensively assess retinal function .

    • Use different light intensities to generate response curves that reveal shifts in sensitivity.

    • Complement functional studies with morphological assessment using histology and immunohistochemistry.

  • Biochemical Analysis:

    • Quantify rhodopsin mRNA expression using qPCR .

    • Analyze retinoid content using high-performance liquid chromatography (HPLC) to assess the impact on visual cycle components .

    • Examine protein levels and localization using Western blot and immunohistochemistry.

  • Control for Environmental Variables:

    • Standardize light exposure conditions, as zebrafish retinal development and function are influenced by light exposure.

    • Maintain consistent temperature (26°C is standard for zebrafish) .

    • Control for circadian effects by performing experiments at consistent times of day.

By systematically applying these approaches, researchers can identify the sources of contradictory results and develop more accurate models of rhodopsin function in zebrafish.

What are the common challenges in obtaining functionally active recombinant Danio rerio Rhodopsin and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant zebrafish rhodopsin:

  • Proper Folding and Membrane Insertion:

    • Challenge: As a seven-transmembrane protein, rhodopsin requires proper folding and membrane insertion for function.

    • Solution: Expression in eukaryotic systems like HEK293T cells can improve folding . If using E. coli, consider specialized strains designed for membrane protein expression. Addition of chaperones or expression at lower temperatures may improve folding.

  • Chromophore Binding:

    • Challenge: For functional studies, rhodopsin must bind 11-cis-retinal correctly.

    • Solution: Carefully monitor 11-cis-retinal availability and regeneration. In zebrafish lacking rlbp1a, 11-cis-retinal levels decline steeply upon illumination and regenerate to only 57% of dark-adapted levels after redark adaptation . Consider supplementing with exogenous chromophore when working with recombinant systems.

  • Protein Stability:

    • Challenge: Rhodopsin can be unstable after purification.

    • Solution: Use stabilizing buffers containing 6% trehalose at pH 8.0 . Aliquot and store with 5-50% glycerol at -20°C/-80°C to prevent repeated freeze-thaw cycles .

  • Detergent Selection:

    • Challenge: Inappropriate detergents can denature the protein or affect its function.

    • Solution: Test multiple detergents (DDM, OG, CHAPS) at various concentrations to identify optimal conditions for your specific application.

  • Assessing Functional Activity:

    • Challenge: Confirming that recombinant rhodopsin is functionally active.

    • Solution: UV-visible spectroscopy can confirm proper folding and chromophore binding. The protein should show characteristic absorption around 500 nm in darkness and shift upon light exposure . For in-cell studies, calcium imaging or electrophysiology can assess functional responses to light.

How can researchers accurately quantify rhodopsin expression levels in zebrafish models?

Accurate quantification of rhodopsin expression in zebrafish models requires multiple complementary approaches:

  • mRNA Quantification:

    • qRT-PCR: Provides precise quantification of rhodopsin mRNA expression. This approach revealed reduced rhodopsin expression at 5 dpf and in adults in both rlbp1a−/− single and double knockout zebrafish .

    • RNA-Seq: Offers comprehensive transcriptome analysis and can identify compensatory changes in expression of related genes.

    • In situ Hybridization: Allows visualization of spatial expression patterns in retinal sections.

  • Protein Quantification:

    • Western Blotting: Quantifies total rhodopsin protein levels when antibodies are available.

    • ELISA: Provides more precise quantification than Western blotting.

    • Mass Spectrometry: Offers absolute quantification and can distinguish between different rhodopsin variants.

  • Functional Assessment:

    • Spectrophotometry: Measures rhodopsin content by difference spectroscopy before and after bleaching.

    • ERG: Provides indirect assessment of functional rhodopsin levels. The sensitivity shift observed in rlbp1a−/− zebrafish (approximately one log unit) and reduced maximum amplitudes in ERG responses indicate reduced functional rhodopsin .

  • Histological Analysis:

    • Immunohistochemistry: Visualizes rhodopsin localization and relative abundance in retinal sections.

    • Outer Segment Morphology: Rod outer segment length and morphology correlate with rhodopsin expression. In rlbp1a−/− larvae, fewer rod outer segments were observed in the ventral retinal periphery .

By combining these multiple approaches, researchers can obtain a comprehensive assessment of rhodopsin expression levels that accounts for transcriptional, translational, and post-translational regulation.

How might structural differences in zebrafish rhodopsin variants inform the development of optogenetic tools?

The multiple rhodopsin variants in zebrafish offer unique structural features that could inform next-generation optogenetic tools:

  • Differential Light Sensitivity:

    • Zebrafish rhodopsin variants and their associated regulatory proteins (like recoverin isoforms) operate under different light regimes . This property could be exploited to develop optogenetic tools with varying light sensitivities for different experimental conditions.

    • The rh1-2 gene product activates in response to light with an absorption spectrum around 500 nm , providing a potential template for optogenetic tools activated by visible light.

  • Membrane Trafficking Optimization:

    • The critical role of hydrophobic interactions between TM1 and H8 in rhodopsin transport suggests specific structural modifications that could enhance membrane trafficking of optogenetic tools.

    • Identifying the minimal structural requirements for efficient ciliary transport based on zebrafish rhodopsin variants could improve the performance of optogenetic tools in specialized cellular compartments.

  • Adaptation Mechanisms:

    • The differential expression of recoverin isoforms (zRec1a, zRec1b, zRec2a, zRec2b) and their specific pairings with kinases (GRK1a-Rec1a, GRK7a-Rec2a) provides a framework for engineering optogenetic tools with regulated desensitization and resensitization properties.

    • This could lead to tools with adjustable temporal response characteristics.

  • Visual Cycle Independence:

    • Studies of rlbp1a knockout zebrafish show that responses of cone photoreceptors are not completely absent even after exposure to bright bleaching light, indicating some resilience in chromophore regeneration .

    • Understanding these mechanisms could lead to optogenetic tools that maintain function under repeated or prolonged stimulation.

What insights can comparative analysis between zebrafish and mammalian rhodopsin provide for retinal degeneration research?

Comparative analysis between zebrafish and mammalian rhodopsin systems offers valuable insights for retinal degeneration research:

  • Regenerative Capacity Differences:

    • Unlike mammals, zebrafish can regenerate photoreceptors after damage. Studying how rhodopsin expression is regulated during regeneration could inform regenerative therapies for mammalian retinal degeneration.

    • The regeneration of 11-cis-retinal after photobleaching differs between wild-type and mutant zebrafish , providing a model for studying visual cycle defects that lead to retinal degeneration in humans.

  • Multiple Rhodopsin Variants:

    • The presence of multiple rhodopsin genes in zebrafish (rh1, rh1-2, exorhodopsin) versus a single rhodopsin gene in mammals allows researchers to study how different rhodopsin variants contribute to photoreceptor survival and function.

    • Understanding why certain variants are more resistant to misfolding or aggregation could inform therapeutic approaches for rhodopsin-associated retinal degenerations.

  • Retinoid Metabolism:

    • Zebrafish knockout models for genes involved in the visual cycle, such as rlbp1a, develop age-dependent photoreceptor degeneration with subretinal lipid deposits , similar to some forms of human retinal degeneration.

    • The observation that double knockout of rlbp1a and rlbp1b leads to slightly better preservation of rod outer segments than rlbp1a knockout alone suggests complex compensatory mechanisms that could be therapeutically relevant.

  • Development and Aging Models:

    • The ability to easily study zebrafish from embryonic stages through adulthood provides a complete picture of how rhodopsin-related defects manifest over time.

    • The finding that rhodopsin mRNA expression is reduced in both larval (5 dpf) and adult rlbp1a knockout zebrafish highlights the importance of studying age-dependent changes in rhodopsin expression and function.

These comparative insights can guide the development of more effective therapies for retinal degenerations caused by rhodopsin mutations or visual cycle defects in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.