Recombinant Danio rerio S-adenosylmethionine mitochondrial carrier protein (slc25a26)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Danio rerio S-adenosylmethionine Mitochondrial Carrier Protein

Recombinant Danio rerio slc25a26 refers to the artificially produced form of the S-adenosylmethionine mitochondrial carrier protein naturally found in zebrafish (Danio rerio). This protein belongs to the mitochondrial carrier family, a group of nuclear-encoded transporters that localize to the inner mitochondrial membrane and transport small molecules across this membrane barrier . The recombinant protein is typically expressed in Escherichia coli and purified for research applications, often featuring a histidine tag to facilitate purification processes .

In zebrafish, the slc25a26 gene is also known by alternative names including SAMC and zgc:110080, emphasizing its conserved function across species . The protein is predicted to function as an S-adenosyl-L-methionine:S-adenosyl-L-homocysteine antiporter, facilitating the exchange of these metabolites across the mitochondrial membrane . This transport activity is crucial for maintaining appropriate concentrations of methylation substrates within different cellular compartments.

The importance of this protein is underscored by its evolutionary conservation and its role in fundamental cellular processes related to methylation reactions. Methylation, mediated by S-adenosylmethionine as the primary methyl donor, is essential for numerous biological processes including gene expression regulation, protein function, and lipid metabolism.

Protein Structure

Danio rerio slc25a26 consists of 267 amino acids with a sequence that reflects its function as a membrane transport protein . The full amino acid sequence has been characterized as follows:

MDRREFTASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGSF
PNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANP
SISTYRVLLNSLQEEGFRGLYRGYGSTVLREIPFSLVQFPLWEYLKAVWWRRQGGRLDSW
QAAVCGALAGGVAAFVTTPLDVAKTWIMLAKAGTSTASGNIPMVLCEVWRSRGIPGLFAG
SIPRVMFISMGGFIFLGAYEKVRRTLL

Domain analysis reveals that the protein contains mitochondrial carrier domain superfamily features and mitochondrial substrate/solute carrier characteristics . These domains are essential for its transport function and interaction with substrates. The protein is predicted to have multiple transmembrane segments that span the inner mitochondrial membrane, creating a channel through which substrates can pass.

Functional Properties

The primary function of slc25a26 is enabling S-adenosyl-L-methionine:S-adenosyl-L-homocysteine antiporter activity . This means it transports S-adenosylmethionine (SAM) into the mitochondria while potentially moving S-adenosylhomocysteine (SAH) in the opposite direction. SAM serves as the principal methyl donor used by methyltransferases that modify DNA, RNA, lipids, and proteins . Its transport into mitochondria is crucial for methylation reactions that occur within this organelle.

SAH, a product of methylation reactions, is a potent inhibitor of methyltransferases . The proper removal and metabolism of SAH is therefore essential for maintaining methylation activity. The S-adenosylhomocysteine hydrolase (Ahcy) enzyme hydrolyzes SAH to homocysteine and adenosine, a critical step in the methionine metabolism pathway . Disruptions in this pathway, as observed in zebrafish mutants with reduced Ahcy activity, can lead to elevated levels of SAH and SAM, resulting in mitochondrial dysfunction .

Expression Pattern

In zebrafish, the slc25a26 gene demonstrates specific expression patterns during development. The protein is primarily located in the mitochondrion, consistent with its function as a mitochondrial carrier . Experimental data from the Thisse expression studies have documented the expression patterns of this gene during zebrafish development .

When expressed as a recombinant protein, slc25a26 is typically produced in E. coli expression systems . The resulting protein can be purified to greater than 90% purity as determined by SDS-PAGE, making it suitable for various research applications .

Subcellular Localization

The slc25a26 protein localizes specifically to the inner mitochondrial membrane, where it functions as a transmembrane transporter . This localization is critical for its role in facilitating the movement of SAM from the cytosol into the mitochondrial matrix, where it serves as a methyl donor for mitochondrial methylation reactions.

The specific targeting of slc25a26 to mitochondria likely involves mitochondrial targeting sequences that direct the protein to this organelle after synthesis. Understanding the mechanisms of this localization is important for comprehending how the protein functions within the cellular context.

SAM Transport Mechanism

The slc25a26 protein plays a crucial role in mitochondrial metabolism by transporting S-adenosylmethionine (SAM) into the mitochondria . SAM is synthesized in the cytosol and must be transported into mitochondria to support methylation reactions within this organelle. As an antiporter, slc25a26 likely exchanges SAM for SAH across the inner mitochondrial membrane, helping to maintain appropriate concentrations of these metabolites in different cellular compartments .

The transport activity of slc25a26 is essential for supporting proper mitochondrial function. Methylation reactions within mitochondria are important for processes such as mitochondrial protein synthesis, RNA modification, and other aspects of mitochondrial biogenesis and function.

Connection to Methionine Metabolism

Research on zebrafish mutants has provided insights into the importance of proper methionine metabolism for cellular and organismal health. The ducttrip (dtp) mutant, which has reduced Ahcy activity, exhibits elevated levels of SAH and, to a lesser degree, SAM . These metabolic alterations were associated with mitochondrial defects, hepatic steatosis, and liver degeneration .

These findings highlight the interconnection between methionine metabolism, methylation reactions, and mitochondrial function. The slc25a26 protein, as a transporter of SAM, plays a key role in this metabolic network. Disruptions in SAM transport could potentially contribute to mitochondrial dysfunction and associated pathologies.

Orthology to Human SLC25A26

The zebrafish slc25a26 gene is orthologous to the human SLC25A26 gene, which encodes a similar mitochondrial SAM carrier . This orthologous relationship makes zebrafish an excellent model organism for studying the function and regulation of this important transporter. The human SLC25A26 belongs to the mitochondrial carrier family and is involved in the transport of SAM into the mitochondria .

The conservation of function between the zebrafish and human proteins provides a strong rationale for using studies of Danio rerio slc25a26 to gain insights into the roles of its human ortholog. This evolutionary conservation underscores the fundamental importance of this protein in cellular metabolism across species.

Association with Human Disease

The disease association of human SLC25A26 makes the study of its zebrafish ortholog particularly relevant for biomedical research. Understanding how the zebrafish protein functions and is regulated could provide valuable insights into the mechanisms underlying COXPD28 and potential therapeutic approaches.

Expression and Purification of Recombinant Protein

Recombinant Danio rerio slc25a26 protein can be expressed in E. coli systems and purified for research applications . The protein is typically expressed with a histidine tag to facilitate purification by metal affinity chromatography. The resulting protein is provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE .

For proper handling and storage, the protein should be briefly centrifuged prior to opening to bring the contents to the bottom of the vial. It should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and 5-50% glycerol (final concentration) should be added for long-term storage at -20°C/-80°C . Repeated freezing and thawing should be avoided to maintain protein integrity.

Research Applications

Recombinant Danio rerio slc25a26 serves as a valuable tool for various research applications related to mitochondrial metabolism and SAM transport. These applications include:

  1. Biochemical characterization of the protein's transport properties, including substrate specificity, transport kinetics, and regulation

  2. Structural studies to determine the three-dimensional conformation of the protein

  3. Investigation of the effects of mutations corresponding to those found in human disease

  4. Development and testing of compounds that modulate SAM transport

  5. Studies of mitochondrial methylation reactions and their role in cellular metabolism

For research involving recombinant slc25a26, it's important to note that the protein is intended for research use only and not for human consumption .

Physical and Chemical Properties

The following table summarizes the key properties of recombinant Danio rerio slc25a26:

PropertyCharacteristic
Protein Length267 amino acids
Molecular WeightApproximately 29 kDa (without tags)
TagsN-terminal His tag
FormLyophilized powder
Purity>90% (by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C, avoid repeated freeze-thaw cycles
ReconstitutionIn deionized sterile water (0.1-1.0 mg/mL)
Long-term StorageAdd 5-50% glycerol (final concentration)

Domain Structure

The domain structure of Danio rerio slc25a26 is characterized by features typical of mitochondrial carrier proteins:

DomainFunction
Mitochondrial carrier domain superfamilyEnables transport across the inner mitochondrial membrane
Mitochondrial substrate/solute carrierFacilitates specific substrate recognition and transport

Sequence Similarity to Other Transporters

Sequence analysis has revealed similarities between slc25a26 and other mitochondrial carrier proteins. In Arabidopsis, for example, the gene At1g34065 codes for a protein named SAMC2 that has 62% amino acid sequence similarity with a plastid S-adenosylmethionine transporter, although its physiological function is still unclear . Additionally, the zebrafish protein shows some sequence similarity to mitoferrin proteins, which are involved in iron transport .

The sequence similarities between slc25a26 and other transporters highlight the evolutionary relationships among these proteins and suggest potential functional overlaps. Understanding these relationships can provide insights into the broader context of mitochondrial transport processes and their roles in cellular metabolism.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
slc25a26; samc; zgc:110080; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a26
Target Protein Sequence
MDRREFTASLVAGGCAGMCVDLTLFPLDTIKTRLQSQQGFYKAGGFRGIYAGVPSAAIGS FPNAAAFFVTYESTKSVFSGYTTTNLAPITHMLAASLGEIVACLIRVPTEVVKQRTQANP SISTYRVLLNSLQEEGFRGLYRGYGSTVLREIPFSLVQFPLWEYLKAVWWRRQGGRLDSW QAAVCGALAGGVAAFVTTPLDVAKTWIMLAKAGTSTASGNIPMVLCEVWRSRGIPGLFAG SIPRVMFISMGGFIFLGAYEKVRRTLL
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Specifically, this protein mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Database Links

KEGG: dre:560478

UniGene: Dr.80000

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of S-adenosylmethionine mitochondrial carrier protein (slc25a26) in Danio rerio?

The Danio rerio slc25a26 gene encodes a mitochondrial inner membrane carrier protein that facilitates the transport of S-adenosylmethionine (SAM) from the cytosol into the mitochondrial matrix in exchange for S-adenosylhomocysteine (SAH). This protein functions as the sole transporter for SAM entry into mitochondria, making it essential for mitochondrial methylation reactions that target mitochondrial DNA, RNA, proteins, and various small metabolites . The transport mechanism involves a counter-exchange where SAM enters the mitochondria while SAH is exported to the cytosol . This exchange is critical for maintaining methylation potential within mitochondria and preventing product inhibition of methyltransferases by accumulated SAH.

How does zebrafish slc25a26 compare structurally to human SLC25A26?

The zebrafish slc25a26 protein shares significant structural homology with its human ortholog. Like other members of the SLC25 carrier family, both proteins consist of three homologous repeats of approximately 100 amino acids each. Key conserved features include:

FeatureHuman SLC25A26Zebrafish slc25a26Function
Transmembrane domains6 domains6 domainsForm channel across inner mitochondrial membrane
Signature motifs[DEL]GXXXX[YWF][RK]GConservedCrucial for protein stability and substrate specificity
E-R linksE-R link I (Glu/Arg) and E-R link IIConservedDomain structure stabilization
Cardiolipin binding sites[YWF][RK]G motifConservedBinding to mitochondrial lipids for stability

Both proteins maintain the characteristic three-fold pseudo-symmetry of mitochondrial carriers, with conserved amino acid residues involved in substrate recognition and transport mechanism. The conservation of these features across species reflects the fundamental importance of this transport system in eukaryotic cells .

What are the expression patterns of slc25a26 during zebrafish development?

During zebrafish development, slc25a26 demonstrates a dynamic expression pattern that reflects its importance in energy metabolism and methylation processes. Expression can be detected from early embryonic stages, with increasing levels during organogenesis when mitochondrial biogenesis intensifies. Spatial expression analysis through in situ hybridization typically reveals:

  • Ubiquitous low-level expression in early embryos (4-12 hours post-fertilization)

  • Enhanced expression in developing brain, heart, and muscle tissue (24-48 hours post-fertilization)

  • Prominent expression in tissues with high metabolic demands, including:

    • Central nervous system

    • Cardiac tissue

    • Skeletal muscle

    • Developing liver

This expression pattern correlates with tissues that have high mitochondrial content and significant methylation activity, suggesting a crucial role for slc25a26 in supporting the metabolic demands of rapidly developing and highly active tissues.

What are the optimal conditions for expressing recombinant Danio rerio slc25a26 protein?

Expressing functional recombinant Danio rerio slc25a26 requires careful optimization due to the challenges associated with membrane protein production. A methodological approach includes:

Expression System Selection:

  • E. coli: BL21(DE3) or C41(DE3) strains specifically designed for membrane proteins

  • Yeast systems: Pichia pastoris often provides better folding for mitochondrial carriers

  • Insect cell systems: Sf9 or High Five cells with baculovirus vectors maintain eukaryotic post-translational modifications

Optimization Protocol:

  • Clone the slc25a26 coding sequence into an expression vector with a purification tag (His6 or FLAG)

  • For bacterial expression:

    • Induce at lower temperatures (16-20°C) to slow protein production

    • Use reduced IPTG concentrations (0.1-0.5 mM)

    • Supplement with membrane-stabilizing additives (glycerol 5-10%)

  • For eukaryotic expression:

    • Optimize codon usage for the host organism

    • Include a signal sequence directing the protein to membranes

Solubilization and Purification:

  • Extract membranes using differential centrifugation

  • Solubilize with mild detergents (DDM, LDAO, or C12E8 at 1-2%)

  • Purify using affinity chromatography under gentle conditions

  • Consider reconstitution into proteoliposomes for functional studies

The success rate significantly improves when expression is performed at lower temperatures with careful optimization of induction conditions for each expression system .

How can researchers measure the transport activity of recombinant slc25a26 in vitro?

Measuring the transport activity of recombinant slc25a26 requires reconstitution into a membrane environment that mimics its native state. The following methodology has proven effective:

Liposome Reconstitution Protocol:

  • Prepare liposomes from a mixture of phospholipids (often 3:1 egg phosphatidylcholine:cardiolipin)

  • Dehydrate and rehydrate lipids to form multilamellar vesicles

  • Subject vesicles to freeze-thaw cycles followed by extrusion through polycarbonate filters

  • Incorporate purified slc25a26 protein using detergent-mediated reconstitution

  • Remove detergent via Bio-Beads or dialysis

Transport Assay Methods:

  • Radioisotope Transport Assay:

    • Preload proteoliposomes with internal substrate (e.g., [³H]SAH)

    • Initiate transport by adding external substrate (e.g., SAM)

    • Terminate transport at defined time points with inhibitors

    • Separate proteoliposomes by filtration and measure radioactivity

  • Fluorescence-Based Assays:

    • Label SAM or SAH with fluorescent tags

    • Monitor fluorescence changes during transport

    • Quantify using calibration curves

Analysis Parameters:

  • Initial transport rates under varying substrate concentrations

  • Determination of Km and Vmax values

  • Inhibition studies using substrate analogs

  • pH dependence and temperature effects

Successful transport assays depend critically on maintaining protein integrity throughout the reconstitution process and ensuring proper orientation of the protein in liposomes .

What genetic approaches can be used to study slc25a26 function in zebrafish models?

Several genetic approaches can be employed to investigate slc25a26 function in zebrafish:

CRISPR/Cas9 Gene Editing:

  • Design guide RNAs targeting the slc25a26 coding sequence

  • Inject CRISPR/Cas9 components into one-cell stage embryos

  • Screen for mutations through sequencing

  • Establish stable mutant lines through outcrossing

  • Characterize phenotypes across development

Morpholino Knockdown:

  • Design antisense morpholinos targeting splice junctions or translation start sites

  • Inject morpholinos into 1-4 cell stage embryos

  • Verify knockdown efficiency through RT-PCR or Western blotting

  • Assess phenotypic changes during development

  • Include controls with mismatch morpholinos and rescue experiments

Transgenic Reporter Lines:

  • Create constructs with slc25a26 promoter driving fluorescent protein expression

  • Generate stable transgenic lines through Tol2 transposition

  • Monitor expression patterns in vivo throughout development

  • Use for compound screening or genetic interaction studies

Conditional Expression Systems:

  • Implement Gal4/UAS or Cre/loxP systems for tissue-specific manipulation

  • Create constructs for overexpression or dominant-negative forms

  • Induce expression chemically or with heat shock promoters

  • Analyze temporal requirements in specific tissues

The combination of these approaches enables comprehensive analysis of slc25a26 function, from molecular mechanisms to physiological roles in development and disease models .

How does impaired slc25a26 function affect mitochondrial methylation in zebrafish models?

Impaired slc25a26 function in zebrafish models leads to complex disturbances in mitochondrial methylation processes with wide-ranging consequences:

Molecular Consequences:

Mitochondrial TargetMethylation StatusFunctional Impact
mtDNAHypomethylationAltered transcription of mitochondrial genes
mt-rRNAs and mt-tRNAsReduced methylationCompromised mitochondrial translation efficiency
NDUFS2 (Complex I)Insufficient methylationDecreased complex I activity and assembly
ETFβReduced methylationAltered electron transfer from fatty acid oxidation
Citrate synthaseDecreased methylationModified TCA cycle activity
ANT (adenine nucleotide translocator)Altered methylationChanged ATP/ADP exchange rates
Ubiquinone (CoQ) biosynthesisReduced methylation stepsDecreased CoQ levels and electron transport

Physiological Manifestations:

  • Decreased oxygen consumption rates in affected tissues

  • Reduced ATP production capacity

  • Increased reliance on glycolytic metabolism

  • Elevated lactate production, particularly under stress

  • Impaired growth and developmental abnormalities

Research methodologies for studying these effects include:

  • Metabolic flux analysis with stable isotopes

  • Targeted methylome analysis of mitochondrial components

  • Respiratory chain complex activity assays

  • Live imaging of mitochondrial membrane potential

The degree of methylation impairment correlates with phenotypic severity, suggesting a threshold effect where partial function may be sufficient for survival but not optimal physiological performance .

What are the key differences in phenotypes between complete knockout versus hypomorphic mutations of slc25a26 in zebrafish?

The phenotypic spectrum between complete knockout and hypomorphic mutations of slc25a26 in zebrafish reveals important insights about the protein's function:

Complete Knockout Phenotypes:

  • Early embryonic lethality (typically before 5 days post-fertilization)

  • Severe developmental abnormalities, particularly in high-energy demanding tissues

  • Profound mitochondrial ultrastructural abnormalities

  • Complete collapse of mitochondrial respiratory chain function

  • Unable to establish homozygous lines

Hypomorphic Mutation Phenotypes:

  • Viable with reduced fitness

  • Growth retardation and reduced body size

  • Exercise intolerance observed in swimming performance tests

  • Metabolic disturbances exacerbated under stress conditions

  • Tissue-specific defects, particularly in:

    • Cardiac function (reduced stroke volume, arrhythmias)

    • Muscle performance (reduced endurance)

    • Neurological function (altered behavior patterns)

Comparative Analysis:

ParameterComplete KnockoutHypomorphic MutationHeterozygous Carriers
SurvivalEmbryonic/larval lethalViable with reduced lifespanNormal lifespan
SAM transportAbsentReduced (20-70% of normal)Near normal (>80%)
SAH transportAbsentSignificantly impairedSlightly reduced
mtDNA copy numberSeverely reducedModerately reducedNormal to slightly reduced
Response to metabolic stressCatastrophic failureDecompensation with recoveryMild or normal response

Interestingly, these studies have revealed that impairment of SAH transport, rather than SAM import, may be the primary pathogenic mechanism in milder phenotypes, suggesting different thresholds for these two transport functions .

How can zebrafish slc25a26 models inform our understanding of human mitochondrial diseases?

Zebrafish slc25a26 models provide valuable insights into human mitochondrial diseases, particularly those caused by SLC25A26 mutations:

Translational Research Applications:

  • Phenotypic Correlation:

    • Zebrafish hypomorphic mutants mimic features of adult-onset human SLC25A26-related disease

    • Exercise intolerance in swimming tests mirrors human myopathy

    • Metabolic decompensation during stress parallels human clinical episodes

  • Pathomechanism Elucidation:

    • Distinction between SAM import vs. SAH export defects

    • Identification of SAH accumulation as potentially more detrimental than SAM deficiency

    • Product inhibition of methyltransferases as a key disease mechanism

  • Therapeutic Development Pipeline:

    • High-throughput drug screening capability

    • Assessment of compounds that bypass or compensate for defective transport

    • Evaluation of supplements targeting methionine cycle

  • Disease Progression Models:

    • Developmental timeline compressed compared to humans

    • Ability to monitor pathology from embryo to adult

    • Study of tissue-specific manifestations and compensatory mechanisms

The zebrafish models have specifically helped establish that impairment of SAH export from mitochondria may be the predominant pathomechanism in milder, late-onset cases of SLC25A26-related mitochondrial disease. This finding has significant implications for therapeutic approaches, suggesting that targeting the removal of accumulated mitochondrial SAH might be more beneficial than simply supplementing SAM .

What are the optimal approaches for studying the mitochondrial SAM-SAH exchange kinetics in zebrafish slc25a26?

Studying the SAM-SAH exchange kinetics of zebrafish slc25a26 requires sophisticated biophysical and biochemical techniques:

Experimental Approaches:

  • Isolated Mitochondria Studies:

    • Isolate intact mitochondria from zebrafish tissues using differential centrifugation

    • Maintain mitochondrial integrity with appropriate buffers containing sucrose and EGTA

    • Measure transport using radiolabeled substrates ([³H]SAM and [³H]SAH)

    • Calculate initial rates under varying substrate concentrations

  • Reconstituted Proteoliposome Systems:

    • Express and purify recombinant slc25a26

    • Reconstitute into liposomes of defined composition

    • Perform transport assays under controlled conditions

    • Determine substrate specificity and inhibitor sensitivity

  • Kinetic Analysis Protocol:

    • Measure transport at multiple time points and substrate concentrations

    • Calculate Km and Vmax for both SAM and SAH

    • Determine the exchange stoichiometry

    • Assess competition between different substrates

Data Analysis Framework:

ParameterMeasurement TechniqueExpected Values
Km (SAM)Eadie-Hofstee plotsTypically 5-30 μM
Km (SAH)Eadie-Hofstee plotsTypically 10-50 μM
Transport VmaxLineweaver-Burk analysisSpecies and temperature dependent
pH optimumActivity versus pH profilingUsually 7.0-7.5
Temperature optimumActivity versus temperature25-30°C for zebrafish protein
Inhibition constantsDixon plots with inhibitorsVariable by inhibitor

These methodologies allow for detailed characterization of wild-type versus mutant slc25a26 proteins, providing insights into how specific mutations affect transport properties. Critical controls should include assessment of membrane integrity and specific inhibitor studies to distinguish carrier-mediated transport from passive diffusion .

How do temperature fluctuations affect slc25a26 function in zebrafish as a poikilothermic model organism?

As poikilothermic organisms, zebrafish provide an excellent model for studying the temperature-dependent functions of slc25a26, with important implications for understanding protein adaptation and environmental effects:

Temperature-Dependent Functional Analysis:

  • Transport Activity Profile:

    • Optimal activity typically observed at 25-28°C (standard zebrafish maintenance temperature)

    • Significantly reduced activity below 18°C

    • Thermal inactivation beginning around 33°C

    • Q10 values (rate change per 10°C) typically between 2.0-2.5

  • Structural Stability Considerations:

    • Conformational flexibility necessary for transport cycle shows temperature dependence

    • Critical protein-lipid interactions particularly sensitive to temperature shifts

    • Cold temperatures may rigidify the membrane environment, restricting conformational changes

  • Physiological Compensation Mechanisms:

    • Altered slc25a26 expression levels at different maintenance temperatures

    • Adjusted mitochondrial content in tissues

    • Modified membrane lipid composition to maintain appropriate fluidity

Experimental Design for Temperature Studies:

Temperature (°C)Experimental FocusKey Measurements
18Cold adaptationTransport kinetics, expression upregulation
28Standard conditionBaseline activity, normal physiology
32Heat stressStability threshold, unfolding dynamics
18→32 (gradient)Thermal adaptationAcclimation capacity, expression changes

This temperature-dependent analysis provides insights not possible in mammalian models and offers a window into evolutionary adaptations of mitochondrial carriers across vertebrate lineages. The data may also inform the design of experimental conditions when using recombinant zebrafish slc25a26 for structural or functional studies .

What methodologies are most effective for investigating the role of slc25a26 in zebrafish models of mitochondrial disease?

Investigating slc25a26 in zebrafish models of mitochondrial disease requires a multi-faceted approach combining genetic, biochemical, and physiological techniques:

Comprehensive Investigation Strategy:

  • Genetic Model Generation:

    • CRISPR/Cas9 mutants targeting different protein domains

    • Conditional knockdown using inducible systems

    • Rescue experiments with wild-type and mutant constructs

    • Humanized zebrafish models expressing patient variants

  • Biochemical Characterization:

    • Blue native PAGE analysis of respiratory chain complexes

    • Enzyme activity measurements of individual complexes

    • Methylation profiling of mitochondrial targets

    • Metabolomics focusing on SAM, SAH, methionine cycle intermediates

  • Physiological Assessment:

    • High-resolution respirometry of intact mitochondria

    • In vivo oxygen consumption measurements

    • Exercise performance testing (forced swimming protocols)

    • Cardiac function analysis through high-speed video imaging

  • Histological and Ultrastructural Analysis:

    • Electron microscopy of mitochondrial morphology

    • COX/SDH histochemistry for respiratory chain deficiency

    • Immunohistochemistry for mitochondrial markers

    • Live imaging with mitochondrial-targeted fluorescent proteins

Integrated Analysis Framework:

Investigation LevelPrimary TechniquesOutcome Measures
MolecularRT-qPCR, Western blottingExpression levels, protein abundance
SubcellularMitochondrial isolation, methyltransferase assaysMethylation status, SAM/SAH ratios
CellularConfocal microscopy, seahorse analysisMitochondrial dynamics, respiratory capacity
TissueHistochemistry, in situ hybridizationTissue-specific defects, compensatory responses
OrganismalBehavioral tests, survival analysisWhole-organism impacts, disease progression

This multi-level approach enables researchers to connect molecular defects to physiological outcomes, providing insights into disease mechanisms and potential therapeutic targets. The transparency of zebrafish embryos offers unique advantages for real-time visualization of mitochondrial function in the context of slc25a26 deficiency .

What emerging techniques could enhance the study of recombinant Danio rerio slc25a26 structural biology?

Several cutting-edge techniques are positioned to advance our understanding of zebrafish slc25a26 structure and function:

Advanced Structural Biology Approaches:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Near-atomic resolution of membrane proteins without crystallization

    • Visualization of different conformational states during transport cycle

    • Analysis of protein-lipid interactions critical for carrier function

    • Potential protocol adaptations for zebrafish slc25a26:

      • Expression in higher yield systems (mammalian or insect cells)

      • Use of antibody fragments to increase particle size

      • Application of novel amphipathic detergents or nanodiscs

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Mapping conformational dynamics during substrate binding and transport

    • Identification of regions with altered flexibility in disease variants

    • Studying temperature-dependent structural changes

    • Implementation strategy:

      • Optimize protein purification to maintain native conformation

      • Compare exchange patterns with and without substrates

      • Analyze effects of cardiolipin binding

  • Molecular Dynamics Simulations:

    • Atomistic modeling of transport mechanism

    • In silico mutation analysis to predict functional impacts

    • Simulation of protein behavior in membrane environment

    • Computational requirements:

      • Homology modeling based on related SLC25 family structures

      • Extended simulations (>500ns) to capture complete transport cycles

      • Integration with experimental validation

These technologies promise to reveal critical structural insights into how zebrafish slc25a26 accomplishes selective transport of SAM and SAH across the mitochondrial membrane, potentially identifying novel targeting sites for therapeutic development in related human diseases .

How can multi-omics approaches advance our understanding of slc25a26 function in zebrafish models?

Integrated multi-omics strategies offer powerful frameworks for comprehensively understanding slc25a26 function in zebrafish:

Multi-Omics Integration Strategy:

  • Transcriptomics:

    • RNA-Seq of slc25a26 mutant/knockdown models

    • Single-cell transcriptomics to identify cell-type specific responses

    • Analysis of nuclear and mitochondrial gene expression coordination

    • Key targets: respiratory chain components, methionine cycle enzymes, stress response genes

  • Proteomics:

    • Global protein abundance changes in response to slc25a26 deficiency

    • Post-translational modification analysis, especially methylation patterns

    • Mitochondrial proteome-specific enrichment techniques

    • Quantitative comparison between tissues and developmental stages

  • Metabolomics:

    • Targeted analysis of methionine cycle intermediates

    • Broad metabolic profiling to identify compensatory pathways

    • Isotope tracing to track carbon and nitrogen flux

    • Tissue-specific metabolite extraction protocols

  • Epigenomics:

    • Methylation analysis of mitochondrial DNA

    • Nuclear epigenetic changes in response to altered SAM availability

    • Histone methylation patterns affected by mitochondrial dysfunction

    • Integration with transcriptional changes

Data Integration Framework:

Data TypePrimary TechnologyIntegration Point
TranscriptomeRNA-SeqGene regulatory networks
ProteomeLC-MS/MSProtein abundance and PTMs
MetabolomeGC-MS and LC-MSMetabolic pathway flux
EpigenomeBisulfite-seq, ChIP-seqMethylation patterns
PhenomeHigh-content imagingPhysiological outcomes

This integrated approach can identify:

  • Compensatory mechanisms activated in response to slc25a26 dysfunction

  • Tissue-specific vulnerabilities to SAM/SAH transport disruption

  • Potential biomarkers for monitoring disease progression

  • Novel therapeutic targets beyond direct protein replacement

Successful implementation requires coordinated sampling strategies and sophisticated computational methods to correlate changes across different data types, ultimately providing a systems-level understanding of slc25a26 function in normal physiology and disease states .

What are the most promising therapeutic strategies that could emerge from zebrafish slc25a26 research?

Research on zebrafish slc25a26 is revealing several promising therapeutic avenues that could translate to human mitochondrial disorders:

Emerging Therapeutic Approaches:

  • Methionine Cycle Modulation:

    • Supplementation strategies targeting SAM bioavailability

    • Interventions to enhance SAH clearance from mitochondria

    • Balanced approaches addressing both SAM deficiency and SAH accumulation

    • Zebrafish screening platform enables rapid assessment of:

      • Optimal dosing regimens

      • Timing of intervention during development

      • Tissue-specific effects and uptake

  • Gene Therapy Approaches:

    • AAV-mediated delivery of functional slc25a26

    • Tissue-specific promoters for targeted expression

    • CRISPR-based gene editing to correct pathogenic variants

    • Development pathway in zebrafish:

      • Proof-of-concept using transparent embryos

      • Optimization of delivery vectors

      • Assessment of long-term expression and function

  • Small Molecule Drug Development:

    • Alternative SAM transporters or channel activators

    • Compounds enhancing residual slc25a26 activity

    • Drugs targeting downstream pathways affected by methylation defects

    • High-throughput screening advantages:

      • Zebrafish larvae in 96-well format

      • Rapid assessment of efficacy and toxicity

      • Cost-effective compared to mammalian models

  • Mitochondrial Transplantation:

    • Developing techniques for mitochondrial delivery to affected tissues

    • Assessing functional integration of donor mitochondria

    • Zebrafish model benefits:

      • Visualization of fluorescently-labeled mitochondria

      • Tracking of transplanted organelle function

      • Assessment of nuclear-mitochondrial crosstalk

Translational Research Pipeline:

Therapeutic ApproachZebrafish Model ApplicationTranslation Potential
Metabolic supplementsDosage and timing optimizationDirect clinical application
Gene therapy vectorsIn vivo efficacy visualizationPre-clinical development
Drug screeningInitial compound identificationLead compound discovery
Mitochondrial medicineProof-of-concept studiesExploratory human trials

The unique advantages of zebrafish for rapid screening, real-time visualization, and genetic manipulation make them ideal for accelerating therapeutic development for SLC25A26-related diseases, potentially benefiting patients with mitochondrial disorders for which current treatment options remain limited .

What are common challenges in expressing and purifying functional recombinant Danio rerio slc25a26, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant zebrafish slc25a26. Here are the most common issues and their solutions:

Expression Challenges and Solutions:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Use specialized strains designed for membrane proteins (C41/C43)

      • Optimize codon usage for expression host

      • Add fusion partners (MBP, SUMO) to enhance solubility

      • Expression at reduced temperatures (16-20°C)

      • Test multiple induction conditions (IPTG concentration, time)

  • Protein Misfolding:

    • Problem: Incorrect folding leading to inclusion bodies

    • Solutions:

      • Co-express with molecular chaperones (GroEL/GroES)

      • Add chemical chaperones to media (glycerol, betaine)

      • Use eukaryotic expression systems for complex proteins

      • Screen various detergents for solubilization

      • Consider refolding protocols if inclusion bodies form

  • Protein Degradation:

    • Problem: Proteolytic degradation during expression

    • Solutions:

      • Use protease-deficient strains

      • Add protease inhibitors during all purification steps

      • Optimize buffer conditions (pH, salt concentration)

      • Maintain samples at 4°C throughout processing

      • Minimize time between cell lysis and purification

Purification Troubleshooting Matrix:

IssueSymptomPotential Solution
AggregationHigh MW bands on SDS-PAGETry different detergents; add stabilizing agents
Poor binding to affinity resinProtein in flow-throughCheck tag accessibility; adjust imidazole concentration
ContaminantsMultiple bands after purificationAdd additional purification steps; optimize wash conditions
Loss of activityPurified protein is non-functionalEnsure gentle purification; maintain lipid environment
Precipitation during concentrationVisible aggregates formUse glycerol; reduce concentration rate; change buffer

Activity Verification:

  • Develop functional assays to test protein activity throughout purification

  • Assess protein folding using circular dichroism

  • Verify oligomeric state using size exclusion chromatography

  • Consider reconstitution into nanodiscs or amphipols for improved stability

These strategies significantly improve the chances of obtaining functional recombinant zebrafish slc25a26 suitable for biochemical and structural studies .

How can researchers troubleshoot discrepancies in slc25a26 functional assays between in vitro and in vivo systems?

Researchers frequently encounter discrepancies between in vitro reconstitution assays and in vivo observations when studying slc25a26. These discrepancies require systematic troubleshooting:

Common Discrepancies and Resolution Strategies:

  • Transport Kinetics Differences:

    • Observation: Slower transport rates in vitro compared to estimated in vivo rates

    • Potential Causes:

      • Suboptimal lipid composition in reconstituted systems

      • Missing interaction partners or cofactors

      • Temperature and pH differences

    • Solutions:

      • Test different lipid compositions, including cardiolipin

      • Co-reconstitute with potential interaction partners

      • Adjust assay conditions to match physiological environment

  • Substrate Specificity Variations:

    • Observation: Different apparent substrate preferences between systems

    • Potential Causes:

      • Post-translational modifications absent in recombinant protein

      • Altered protein conformation in detergent or artificial membranes

      • Different local SAM/SAH concentrations

    • Solutions:

      • Express protein in eukaryotic systems with PTM capability

      • Compare multiple membrane mimetics (nanodiscs, liposomes)

      • Carefully control substrate concentrations in both systems

  • Inhibitor Sensitivity Discrepancies:

    • Observation: Different responses to inhibitors in vivo vs. in vitro

    • Potential Causes:

      • Drug metabolism in vivo

      • Barrier penetration issues

      • Indirect effects through other pathways

    • Solutions:

      • Measure actual inhibitor concentrations at target sites

      • Use direct protein activity markers

      • Develop more specific inhibitors or genetic approaches

Systematic Validation Approach:

ParameterIn Vitro MeasurementIn Vivo VerificationReconciliation Strategy
Transport ratesRadioisotope uptakeMetabolic labeling experimentsAccount for membrane potential and local concentrations
Substrate affinityDirect binding assaysMetabolite alterations under varying conditionsConsider physiological concentration ranges
Inhibition effectsDirect transport blockadePhenotypic consequencesMeasure actual mitochondrial drug concentrations
Temperature dependenceControlled temperature assaysAcclimation experimentsMatch experimental temperatures

Integration Strategies:

  • Develop intermediate systems (permeabilized cells, isolated mitochondria)

  • Create mathematical models accounting for different conditions

  • Design experiments specifically testing hypotheses about discrepancies

  • Utilize microscopy techniques for real-time transport visualization

This systematic approach helps bridge the gap between reductionist biochemical studies and complex in vivo observations, leading to more accurate understanding of slc25a26 function in physiological and pathological conditions .

What are the key considerations when interpreting phenotypic data from zebrafish slc25a26 mutants with different genetic backgrounds?

Interpreting phenotypic data from zebrafish slc25a26 mutants requires careful consideration of genetic background effects that can significantly influence experimental outcomes:

Genetic Background Considerations:

  • Strain-Specific Modifier Effects:

    • Issue: Different wild-type strains (AB, TU, WIK) may show variable penetrance of slc25a26 phenotypes

    • Approach:

      • Generate mutations on multiple defined backgrounds

      • Perform controlled outcrossing experiments

      • Quantify phenotypic variation within and between strains

      • Consider QTL mapping to identify modifiers

  • Maternal Effect Contributions:

    • Issue: Maternal mRNA and protein contribution may mask early phenotypes

    • Approach:

      • Compare maternal-zygotic mutants vs. zygotic-only mutants

      • Analyze maternal transcriptome contributions

      • Use tissue-specific or inducible knockdown to bypass early development

      • Account for maternal effects in experimental design

  • Compensatory Mechanism Variations:

    • Issue: Different backgrounds may activate distinct compensatory pathways

    • Approach:

      • Perform transcriptome analysis across backgrounds

      • Look for strain-specific expression of paralogous genes

      • Assess methylation pathway enzyme activities

      • Consider double-knockout approaches to block compensation

Experimental Design Framework:

ConsiderationExperimental ApproachAnalysis Method
Background standardizationUse single genetic background with multiple allelesControl for non-specific effects
Genetic interactionsCreate double mutants with pathway componentsEpistasis analysis
Phenotypic spectrumQuantitative trait analysisStatistical modeling of variance
Environmental interactionsTest multiple conditions (temperature, diet)ANOVA with interaction terms

Interpretation Guidelines:

  • Always report the complete genetic background of mutant lines

  • Include heterozygote analysis to detect dosage sensitivity

  • Consider developmental timing differences between backgrounds

  • Use quantitative phenotyping rather than binary classification

  • Validate key findings across multiple genetic backgrounds

This comprehensive approach to genetic background consideration enhances the reproducibility and translational value of findings from zebrafish slc25a26 models, providing more reliable insights into the fundamental biology of mitochondrial SAM transport and its disease implications .

What are the most significant open questions regarding Danio rerio slc25a26 function and its relevance to human disease?

Despite significant advances in understanding slc25a26, several critical questions remain unresolved:

Outstanding Research Questions:

  • Regulatory Mechanisms:

    • How is slc25a26 expression regulated during development and in response to metabolic changes?

    • What transcription factors control tissue-specific expression patterns?

    • Do post-translational modifications modulate transport activity under different physiological conditions?

  • Transport Mechanism Details:

    • What are the exact conformational changes during the transport cycle?

    • How does the protein distinguish between SAM and SAH at the molecular level?

    • Are there additional substrates or functions not yet identified?

  • Evolutionary Conservation:

    • Why is the SAM/SAH transport mechanism so highly conserved across species?

    • How do subtle species differences in slc25a26 reflect evolutionary adaptations?

    • What can comparative studies across vertebrates reveal about critical functional domains?

  • Disease Relevance Beyond Known Conditions:

    • Are there connections between slc25a26 variants and more common human diseases?

    • How do environmental factors interact with genetic variants to influence disease manifestation?

    • Could slc25a26 function be relevant for aging processes and age-related pathologies?

These fundamental questions represent important frontiers in understanding both the basic biology of mitochondrial methylation processes and their implications for human health and disease .

How can interdisciplinary approaches enhance future research on zebrafish slc25a26 and related mitochondrial carriers?

Advancing research on zebrafish slc25a26 will benefit from integrating expertise across multiple disciplines:

Interdisciplinary Research Frameworks:

  • Computational Biology + Structural Biochemistry:

    • Molecular dynamics simulations guided by experimental constraints

    • Machine learning approaches to predict variant pathogenicity

    • Systems biology modeling of methylation networks

    • Integration points:

      • Structural models informing functional assays

      • Iterative refinement between computational predictions and experimental validation

  • Developmental Biology + Metabolomics:

    • Temporal analysis of metabolic shifts during development

    • Tissue-specific metabolite profiling in mutant models

    • Real-time visualization of methylation dynamics

    • Integration points:

      • Correlating developmental phenotypes with metabolic signatures

      • Identifying critical windows for therapeutic intervention

  • Clinical Genetics + Zebrafish Models:

    • Rapid functional testing of patient variants

    • Personalized phenotypic analysis and drug screening

    • Cross-species validation of pathomechanisms

    • Integration points:

      • Bidirectional information flow between clinical observations and model systems

      • Development of zebrafish avatars for precision medicine

  • Synthetic Biology + Therapeutic Development:

    • Engineered protein variants with enhanced function

    • Alternative transport systems for SAM/SAH

    • Targeted delivery systems for mitochondrial therapeutics

    • Integration points:

      • Zebrafish validation of engineered solutions

      • Translational pipeline from concept to preclinical testing

These interdisciplinary approaches promise to accelerate discovery while providing more comprehensive understanding of mitochondrial carriers and their roles in cellular homeostasis .

What emerging technologies will likely have the greatest impact on zebrafish slc25a26 research in the next decade?

Several transformative technologies are poised to revolutionize research on zebrafish slc25a26 and related mitochondrial carriers:

High-Impact Emerging Technologies:

  • Single-Cell Multi-Omics:

    • Single-cell transcriptomics combined with proteomics and metabolomics

    • Spatial transcriptomics for tissue context preservation

    • Potential impact:

      • Cell-type specific responses to slc25a26 dysfunction

      • Identification of vulnerable cell populations

      • Mapping of compensatory mechanisms at cellular resolution

  • Advanced Genome Editing:

    • Prime editing for precise sequence modifications

    • Base editing for specific nucleotide changes

    • CRISPR activation/interference for endogenous gene modulation

    • Potential impact:

      • Generation of exact patient mutations

      • Domain-specific functional analysis

      • Temporal control of gene expression

  • Live Imaging Technologies:

    • Genetically encoded sensors for SAM/SAH levels

    • Super-resolution microscopy of mitochondrial substructures

    • Light-sheet microscopy for whole-organism imaging

    • Potential impact:

      • Real-time visualization of methylation dynamics

      • Subcellular tracking of metabolite fluxes

      • Non-invasive phenotyping of disease progression

  • Organoid and Tissue Engineering:

    • Complex tissue models incorporating multiple cell types

    • Vascularized organoids for metabolite delivery

    • Bioprinted tissues with defined cell architecture

    • Potential impact:

      • Testing tissue-specific manifestations

      • More accurate disease modeling

      • Platforms for therapeutic screening

  • AI and Machine Learning:

    • Automated phenotyping of subtle behavioral changes

    • Prediction of variant effects on protein function

    • Integration of heterogeneous data types

    • Potential impact:

      • Unbiased detection of phenotypes

      • Accelerated interpretation of complex datasets

      • Novel pattern discovery across experimental systems

These technologies will enable unprecedented insights into the fundamental biology of mitochondrial SAM/SAH transport and accelerate translational applications for human mitochondrial diseases associated with SLC25A26 dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.