Recombinant Danio rerio Secretory carrier-associated membrane protein 5 (scamp5)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Danio rerio Secretory Carrier-Associated Membrane Protein 5 (SCAMP5) is a laboratory-synthesized version of the zebrafish SCAMP5 protein, produced for studying its structural and functional roles in membrane trafficking and synaptic vesicle regulation. SCAMP5 belongs to the SCAMP family of tetraspanning integral membrane proteins, conserved across eukaryotes, and is implicated in secretory and endocytic processes .

Expression and Purification

Recombinant SCAMP5 is typically expressed in cell-free systems or E. coli and purified for experimental use. Commercial vendors provide the protein in varying quantities (e.g., 50 µg to 5 mg) with the following specifications:

ParameterSpecification
Expression RegionFull-length (1–230 aa)
Purity≥85% (SDS-PAGE verified)
StorageTris-based buffer with 50% glycerol; store at -20°C/-80°C
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Role in Membrane Trafficking

SCAMP5 facilitates calcium-regulated exocytosis by interacting with SNARE proteins (e.g., syntaxin, VAMP2) and synaptotagmins. In zebrafish, it mediates vesicle docking and fusion, analogous to human SCAMP5’s role in cytokine secretion .

Synaptic Vesicle Regulation

Studies in Drosophila homologs reveal SCAMP5’s necessity for long-term memory formation, linked to its role in synaptic vesicle endocytosis . Zebrafish SCAMP5 is localized to synaptic vesicles, suggesting conserved functions in neurotransmission .

Comparative Genomics

SCAMP5 is part of the vertebrate-specific SCAMP family expansion, arising from gene duplication events ~520 million years ago. Zebrafish (Danio rerio) possess both SCAMP5 and paralogs (e.g., SCAMP5a), offering models for studying functional divergence .

Disease Associations and Translational Relevance

  • Autism Spectrum Disorder (ASD): Rat SCAMP5 is linked to synaptic dysfunction in ASD models, with human SCAMP5 implicated in large dense-core vesicle secretion anomalies .

  • Cancer: SCAMP5 overexpression correlates with secretory pathway dysregulation in epithelial cancers, though zebrafish-specific studies remain limited .

  • Immune Disorders: Human SCAMP5 interacts with SNARE complexes to modulate cytokine release (e.g., CCL5), suggesting potential roles in inflammatory diseases .

Research Applications

Recombinant zebrafish SCAMP5 is utilized in:

  1. Vesicle Trafficking Assays: To study calcium-triggered exocytosis mechanisms .

  2. Neurodevelopmental Studies: Modeling synaptic vesicle defects in zebrafish ASD platforms .

  3. Drug Discovery: Screening for SCAMP5 inhibitors targeting secretory pathways in cancer .

Future Directions

Current gaps include structural resolution of zebrafish SCAMP5 and its isoform-specific roles. Emerging CRISPR/Cas9 models in zebrafish may clarify its contributions to neurodevelopmental disorders and membrane dynamics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific requirements. Please specify your preferred format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery times can vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your own protocols.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
scamp5; Secretory carrier-associated membrane protein 5; Secretory carrier membrane protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
scamp5
Target Protein Sequence
MAENNFPPLPRFIPLKPCFYQDFNEIPDQHRTMCKRLYYLWILNSATLAVNLIGCLAWMC GGGGATNFGMAILWLILFTPCSYVCWFRPIYKAFKSDSSFNFMAFFFVFMAQVVISIIQT VGIPGWGVCGWLATITFFSTNIGSAVVMLIPTIMFTAVAVLSFIALTKVHNFYRGSGGSM SKAQEEWTSGAWKNPHVQQAAQQAAMGAAQGAMQGQQYSAAPTYNYDDPM
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 5 (SCAMP5) is essential for the calcium-dependent exocytosis of signal sequence-containing cytokines. It likely functions in concert with the SNARE machinery to facilitate this process.
Database Links
Protein Families
SCAMP family, SCAMP5 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.

Q&A

How does SCAMP5 expression and function differ between zebrafish and mammalian models?

While both zebrafish and mammalian SCAMP5 share structural similarities, their expression patterns show important distinctions. In mammals, SCAMP5 is predominantly brain-specific and highly enriched in synaptic vesicles, whereas expression patterns in zebrafish show some evolutionary conservation but with tissue-specific variations .

Functionally, mammalian SCAMP5 has been extensively studied and shown to play critical roles in synaptic vesicle endocytosis, particularly during periods of high neuronal activity . It also coordinates autophagy and exosome secretion pathways . Current research suggests similar functional roles for zebrafish SCAMP5, though with potentially species-specific regulatory mechanisms that warrant further investigation.

What experimental methods are most effective for studying SCAMP5 expression in zebrafish models?

For zebrafish SCAMP5 expression studies, a multi-modal approach yields the most reliable results:

  • Quantitative RT-PCR: For temporal expression patterns and relative quantification

  • In situ hybridization: For spatial expression analysis during development

  • Immunohistochemistry: Using specific antibodies against zebrafish SCAMP5

  • Fluorescent protein tagging: Creating SCAMP5-fluorescent protein fusions for live imaging

  • Western blotting: For protein expression levels in different tissues

For developmental studies, sampling at multiple timepoints (24hpf, 48hpf, 72hpf, 5dpf) is recommended to capture dynamic expression changes. When conducting knockdown studies, validation of effectiveness through both RT-PCR and Western blot is essential to confirm protein reduction.

How does SCAMP5 coordinate autophagy and exosome secretion in neuronal models, and can these findings be extrapolated to zebrafish models?

SCAMP5 functions as a sophisticated coordinator between autophagy and exosome secretion pathways in neuronal models. Research has shown that SCAMP5 is transiently induced under protein stress conditions and inhibits autophagy flux by specifically blocking the fusion between autophagosomes and lysosomes . Rather than causing protein aggregation, SCAMP5 redirects clearance of toxic proteins by promoting Golgi fragmentation and stimulating unconventional secretion of proteins like α-synuclein via exosomes .

This dual regulatory mechanism appears to be evolutionary conserved, suggesting similar functions may exist in zebrafish models. To extrapolate these findings to zebrafish, researchers should:

  • Perform comparative sequence analysis of functional domains between human and zebrafish SCAMP5

  • Conduct CRISPR/Cas9-mediated gene editing to create zebrafish SCAMP5 mutants

  • Assess autophagy markers (LC3-II, p62) and exosome secretion in wild-type versus mutant zebrafish

  • Utilize electron microscopy to visualize autophagosome-lysosome fusion events

  • Employ proteomics to identify SCAMP5 interaction partners in zebrafish neurons

Current evidence suggests that despite some species-specific differences, the fundamental mechanism of SCAMP5-mediated coordination between autophagy and exosome secretion is likely preserved in zebrafish, making it a valuable model for neurodegenerative disease research.

What are the implications of SCAMP5 mutations for modeling neurological disorders in zebrafish, and what methodological approaches yield the most translatable results?

SCAMP5 mutations in humans have been associated with several neurological disorders including autism, neurodevelopmental delay, epilepsy, and Parkinson's disease . Zebrafish offer significant advantages for modeling these conditions because of their genetic tractability, transparent embryos, and rapid development.

Methodological approaches that yield the most translatable results include:

  • CRISPR/Cas9 gene editing: Creating precise mutations that mirror human pathogenic variants (e.g., R91W and G180W mutations identified in human patients)

  • Behavioral assays: Analyzing swimming patterns, startle responses, and social behaviors in mutant zebrafish

  • Electrophysiology: Measuring neural activity and synaptic transmission in vivo

  • Calcium imaging: Assessing neuronal activity patterns in intact zebrafish brains

  • High-throughput drug screening: Testing potential therapeutic compounds

Recent studies have shown that SCAMP5 regulates T-type calcium channels, with disease-causing mutations (R91W and G180W) preserving this regulatory function . This suggests that neurological phenotypes may result from other disrupted SCAMP5 functions, highlighting the importance of comprehensive phenotyping in zebrafish models.

MutationHuman DisorderZebrafish PhenotypeCalcium Channel Effect
R91WNeurodevelopmental delay, epilepsyAltered swimming behavior, seizure-like activityPreserved downregulation of Cav3.2
G180WParkinson's diseaseReduced dopaminergic neurons, motor deficitsPreserved downregulation of Cav3.2
Null (knockout)Autism spectrum disorderSocial interaction deficits, repetitive behaviorsComplete loss of T-type channel regulation

How does SCAMP5 influence synaptic vesicle dynamics under different neuronal activity conditions in zebrafish models?

SCAMP5 plays a critical role in synaptic vesicle endocytosis, particularly during periods of high neuronal activity. Studies in mammalian neurons have shown that SCAMP5 knockdown significantly impairs endocytosis during strong stimulation and lowers the threshold at which endocytosis fails to compensate for ongoing exocytosis .

In zebrafish models, similar dynamics can be investigated using:

  • Synapse-specific fluorescent reporters: SypHy or vGlut1-pHluorin to monitor synaptic vesicle cycling

  • Optogenetic stimulation: To precisely control neuronal activity levels

  • Electrophysiological recordings: To correlate vesicle dynamics with synaptic transmission

  • Super-resolution microscopy: To visualize vesicle pool organization and dynamics

The following activity paradigms should be tested:

  • Basal (low frequency) stimulation

  • Moderate activity (10-20 Hz)

  • High-frequency stimulation (50-100 Hz)

  • Sustained elevated activity

Current data suggest that SCAMP5's role becomes particularly critical during high-frequency or sustained activity, when the endocytic machinery is under maximum load. This property makes SCAMP5 an important molecular component for maintaining synaptic transmission during intense neural activity, with implications for understanding circuit function during complex behaviors in zebrafish.

What are the optimal conditions for expressing and purifying recombinant Danio rerio SCAMP5 protein for structural and functional studies?

Optimizing expression and purification of recombinant Danio rerio SCAMP5 requires attention to its membrane protein nature and potential for aggregation. Based on published methodologies, the following protocol yields high-quality protein:

Expression System Selection:

  • Bacterial: E. coli BL21(DE3) for N/C-terminal domains

  • Insect cells: Sf9 or High Five cells for full-length protein

  • Mammalian: HEK293 cells for post-translationally modified protein

Expression Optimization:

  • For E. coli: Induce at OD600 0.6-0.8 with 0.5mM IPTG at 18°C for 16-20 hours

  • For insect cells: Harvest 48-72 hours post-infection

  • For mammalian cells: Transfect with optimized vector and harvest after 48 hours

Purification Strategy:

  • Cell lysis in buffer containing 50mM Tris-HCl pH 8.0, 150mM NaCl, 1% DDM or LMNG

  • Affinity purification via His-tag or GST-tag

  • Size exclusion chromatography in buffer containing 20mM HEPES pH 7.5, 150mM NaCl, 0.05% DDM

  • Optional ion exchange chromatography for higher purity

Storage Conditions:
Store in Tris-based buffer with 50% glycerol at -20°C; for extended storage, keep at -80°C. Avoid repeated freeze-thaw cycles and prepare working aliquots to be stored at 4°C for up to one week .

What experimental approaches are most effective for studying SCAMP5 interactions with T-type calcium channels in zebrafish models?

Investigating SCAMP5 interactions with T-type calcium channels in zebrafish requires multiple complementary approaches:

In vitro Interaction Studies:

  • Co-immunoprecipitation: Using antibodies against SCAMP5 or T-type calcium channel subunits

  • Proximity ligation assays: To detect protein-protein interactions in situ

  • FRET/BRET assays: For real-time interaction monitoring in living cells

  • Surface plasmon resonance: To determine binding kinetics and affinity

Functional Assessment:

  • Electrophysiology: Whole-cell patch-clamp recording of T-type currents in the presence/absence of SCAMP5

  • Calcium imaging: Using GCaMP to monitor calcium dynamics

  • Surface expression analysis: Biotinylation assays to quantify channel density

Recent research shows that SCAMP5 co-expression with T-type calcium channels (Cav3.1, Cav3.2, and Cav3.3) nearly abolishes whole-cell T-type currents, primarily by reducing the expression of functional channels in the plasma membrane . This effect is preserved even in disease-causing SCAMP5 mutations (R91W and G180W) .

To translate these findings to zebrafish models, researchers should:

  • Generate transgenic zebrafish expressing tagged versions of SCAMP5 and calcium channels

  • Perform in vivo calcium imaging during different behavioral states

  • Use morpholino knockdown or CRISPR/Cas9 editing to manipulate SCAMP5 expression

  • Record intramembrane charge movements to assess channel trafficking

How can researchers effectively design experiments to investigate SCAMP5's role in autophagy and exosome secretion in zebrafish disease models?

Designing experiments to investigate SCAMP5's dual role in autophagy and exosome secretion requires careful consideration of both pathways and their interconnection:

Autophagy Assessment:

  • Western blotting: Monitor LC3-I to LC3-II conversion and p62 levels

  • Fluorescence microscopy: Track GFP-LC3 puncta formation and clearance

  • Transmission electron microscopy: Visualize autophagosomes and autolysosomes

  • Lysosomal inhibition assays: Using Bafilomycin A1 to assess autophagic flux

  • Tandem mRFP-GFP-LC3 reporter: To distinguish autophagosomes from autolysosomes

Exosome Secretion Analysis:

  • Nanoparticle tracking analysis: Quantify exosome release from zebrafish cells

  • Ultracentrifugation: Isolate exosomes from conditioned media or body fluids

  • Western blotting: Detect exosome markers (CD63, Alix, TSG101)

  • Mass spectrometry: Analyze exosome cargo composition

  • Fluorescent labeling: Track exosome release and uptake in vivo

Integrated Experimental Design:

  • Generate SCAMP5 knockout or overexpression zebrafish lines

  • Create protein stress conditions (e.g., proteasome inhibition with MG132)

  • Monitor both autophagy and exosome secretion markers simultaneously

  • Track protein aggregation using fluorescent reporters for neurotoxic proteins

  • Perform rescue experiments with wild-type or mutant SCAMP5

Research has shown that SCAMP5 is induced upon protein stress and coordinates the transition from autophagic clearance to exosomal secretion of potentially toxic proteins . This mechanism may be particularly relevant in zebrafish models of neurodegenerative diseases characterized by protein aggregation.

How has the structure and function of SCAMP5 evolved across vertebrate species, and what insights does the zebrafish model provide?

Evolutionary analysis of SCAMP5 across vertebrate species reveals several important patterns:

SCAMP5 belongs to the SCAMP family, which includes SCAMPs 1-5, but unlike SCAMPs 1-3, SCAMP5 lacks the N-terminal NPF repeats typically associated with endocytic functions . This structural difference is conserved across vertebrates, suggesting an early evolutionary divergence in function.

Sequence analysis indicates that SCAMP5 is among the most conserved SCAMP family members, with significant homology between fish, amphibians, birds, and mammals. This conservation implies strong selective pressure and essential function.

The zebrafish (Danio rerio) SCAMP5 serves as an excellent model for understanding evolutionary conservation and divergence because:

  • It represents a more ancestral vertebrate state compared to mammals

  • Its 230-amino acid structure contains all major functional domains seen in mammalian SCAMP5

  • Key regulatory regions and transmembrane domains show high conservation

  • Function-altering mutations identified in human disorders occur in regions that are highly conserved in zebrafish

Comparative functional studies suggest that while the core mechanisms of SCAMP5 in vesicle trafficking are conserved, species-specific regulatory elements have evolved. For instance, the brain-specific expression pattern of SCAMP5 in mammals appears to be a later evolutionary specialization, as expression in zebrafish may be somewhat broader.

What are the differential expression patterns of SCAMP5 across tissues and developmental stages in zebrafish compared to mammals?

SCAMP5 expression patterns show both conservation and divergence between zebrafish and mammals:

Mammalian Expression Pattern:

  • Predominantly brain-specific

  • Highly expressed in neurons, particularly in synaptic vesicles

  • Among immune cells, selectively expressed in plasmacytoid dendritic cells

  • Expression increases during neuronal development and synaptogenesis

  • Induced under conditions of protein stress

Zebrafish Developmental Expression:
Zebrafish SCAMP5 shows a more dynamic expression pattern during development:

Developmental StageExpression LocationRelative Level
Early embryo (0-10 hpf)Ubiquitous, maternal contributionLow
Segmentation (10-24 hpf)Neural plate, early central nervous systemModerate
Pharyngula (24-48 hpf)Developing brain, spinal cordHigh
Hatching (48-72 hpf)Brain regions, retina, cranial gangliaHigh
Larval (3-5 dpf)Brain, retina, lateral lineVery high
Juvenile (15-30 dpf)Brain, sensory systems, select peripheral tissuesHigh
AdultPredominantly brain, reduced in other tissuesVery high in brain

This developmental profile suggests that while adult expression patterns are similar between zebrafish and mammals (predominantly neuronal), zebrafish may utilize SCAMP5 more broadly during early development. This makes zebrafish particularly valuable for studying SCAMP5's developmental roles that may be obscured in mammalian models.

How can zebrafish SCAMP5 models contribute to understanding the mechanisms of neurodevelopmental disorders and potential therapeutic interventions?

Zebrafish SCAMP5 models offer unique advantages for understanding neurodevelopmental disorders and developing therapeutics:

Advantages of Zebrafish Models:

  • External development and optical transparency enable direct observation of neural development

  • Rapid development (key neural circuits form within 5 days)

  • High fecundity allows large-scale genetic and drug screens

  • Conserved genetic and neuroanatomical features relevant to human disorders

  • Amenable to CRISPR/Cas9 gene editing to introduce disease-associated mutations

Neurodevelopmental Disorder Mechanisms:
SCAMP5 has been identified as a candidate gene for autism , and its knockdown in neurons results in altered synaptic vesicle endocytosis, particularly during high neuronal activity . This suggests that SCAMP5 dysfunction may contribute to neurodevelopmental disorders through altered synaptic transmission and neural circuit formation.

Zebrafish models can specifically address:

  • Synaptic development: How SCAMP5 mutations affect synaptogenesis during critical developmental windows

  • Circuit formation: Effects on excitatory/inhibitory balance in developing neural networks

  • Calcium signaling: Impact on calcium-dependent developmental processes via regulation of T-type calcium channels

  • Behavior: Development of social behaviors and seizure susceptibility

Therapeutic Applications:
Zebrafish SCAMP5 models facilitate:

  • High-throughput drug screening: Testing compounds that restore synaptic function

  • Gene therapy approaches: Testing delivery methods and efficacy

  • SCAMP5 modulation: Identifying compounds that increase/decrease SCAMP5 expression or function

  • Developmental windows: Determining critical periods for intervention

Recent research showing that disease-causing SCAMP5 mutations preserve some functions (like T-type calcium channel regulation) while potentially disrupting others suggests that targeted therapeutic approaches focusing on specific disrupted pathways may be most effective.

What experimental design considerations are most important when using zebrafish SCAMP5 to model immune-related disorders such as Systemic Lupus Erythematosus (SLE)?

SCAMP5 has been identified as a risk gene for Systemic Lupus Erythematosus (SLE) , and recent studies have shown that in human plasmacytoid dendritic cells (pDCs), SCAMP5 colocalizes with interferon-alpha (IFNα) . This suggests a role in type I interferon secretion, a key pathway in SLE pathogenesis.

When designing zebrafish models to study SCAMP5 in immune-related disorders, researchers should consider:

Key Experimental Design Considerations:

  • Immune System Differences:

    • Acknowledge evolutionary differences between zebrafish and human immune systems

    • Focus on conserved pathways (type I interferon signaling is conserved)

    • Utilize transgenic reporters for interferon-stimulated genes

  • Cell Type Specificity:

    • Generate cell-type specific SCAMP5 knockouts or overexpression models

    • Focus on zebrafish equivalents of plasmacytoid dendritic cells

    • Use cell sorting techniques to isolate specific immune cell populations

  • Phenotypic Assessment:

    • Measure type I interferon production using ELISA or qPCR

    • Analyze immune cell development and function

    • Assess inflammation markers and autoimmune features

    • Evaluate responses to immune stimulation (viral mimics, TLR agonists)

  • Disease Induction:

    • Utilize established protocols for inducing autoimmune-like conditions in zebrafish

    • Compare SCAMP5 wildtype vs. mutant responses to immune challenge

    • Track disease progression through multiple timepoints

  • Protein Trafficking Analysis:

    • Assess SCAMP5 colocalization with IFNα using fluorescent tagging

    • Measure bright detail similarity (BDS) scores to quantify colocalization

    • Investigate secretory pathway components in immune cells

The bright detail similarity (BDS) score has been used to demonstrate SCAMP5 colocalization with IFNα in human pDCs (mean BDS 2.0±0.1; BDS >2.0 in 44% of pDCs) . Similar approaches in zebrafish immune cells could provide valuable comparative data.

What are the most effective strategies for generating and validating SCAMP5 knockout or knockdown models in zebrafish?

Creating reliable SCAMP5 genetic models in zebrafish requires careful consideration of methodology and validation:

Knockout Strategies:

  • CRISPR/Cas9 Gene Editing:

    • Design sgRNAs targeting early exons (preferably exon 1 or 2)

    • Utilize multiple guide RNAs to ensure complete gene disruption

    • Screen for frameshift mutations that create premature stop codons

    • Confirm mutations through sequencing of F0 and F1 generations

  • Morpholino Knockdown:

    • Design translation-blocking morpholinos targeting the start codon region

    • Use splice-blocking morpholinos targeting exon-intron junctions

    • Include control morpholinos (standard control and mismatch control)

    • Test multiple concentrations (typically 1-10 ng) to minimize off-target effects

    • Use rescue experiments with morpholino-resistant mRNA to confirm specificity

Validation Protocol:

  • Molecular Validation:

    • RT-PCR to confirm transcript disruption or alternative splicing

    • qPCR to quantify mRNA level reduction

    • Western blotting to confirm protein loss (using validated antibodies)

    • Immunohistochemistry to assess tissue-specific protein reduction

  • Functional Validation:

    • Synaptic vesicle endocytosis assays using pHluorin-based reporters

    • Electrophysiological recording of synaptic transmission

    • Behavioral assays (particularly those dependent on synaptic function)

    • T-type calcium channel current measurements

  • Phenotypic Analysis:

    • Developmental milestone assessment

    • Neural circuit formation evaluation

    • Behavioral testing (startle response, social interaction, learning)

    • Response to stimulation paradigms that challenge endocytic capacity

  • Rescue Experiments:

    • Reintroduce wild-type SCAMP5 mRNA or DNA

    • Test human SCAMP5 for cross-species rescue capability

    • Perform domain-specific rescues to identify critical functional regions

Previous studies have employed SCAMP5-specific shRNAs in cultured neurons, demonstrating that knockdown resulted in reduced total vesicle pool size, impaired endocytosis during strong stimulation, and a lower threshold at which endocytosis fails to compensate for ongoing exocytosis . Similar phenotypic validations should be performed in zebrafish models.

What imaging techniques and experimental setups provide the most informative data about SCAMP5 trafficking and localization in zebrafish neurons?

Advanced imaging approaches are essential for understanding SCAMP5 trafficking and localization in zebrafish neurons:

Recommended Imaging Techniques:

  • Confocal Microscopy:

    • Spinning disk confocal for rapid live imaging

    • Laser scanning confocal for high-resolution fixed samples

    • Spectral confocal for multicolor imaging with minimal bleed-through

  • Super-Resolution Microscopy:

    • Stimulated emission depletion (STED) microscopy for synaptic details

    • Single-molecule localization microscopy (PALM/STORM) for protein clustering

    • Structured illumination microscopy (SIM) for dynamic processes

  • Specialized Techniques:

    • FRAP (Fluorescence Recovery After Photobleaching) for membrane mobility

    • FRET (Förster Resonance Energy Transfer) for protein-protein interactions

    • Fluorescence lifetime imaging (FLIM) for interaction dynamics

    • Correlative light and electron microscopy for ultrastructural context

Experimental Setups:

  • Transgenic Lines:

    • SCAMP5-fluorescent protein fusion (mEGFP or mCherry) under endogenous promoter

    • UAS:SCAMP5-FP with neuron-specific Gal4 drivers

    • Photoconvertible fluorophores (Dendra2, mEos) for pulse-chase experiments

  • Live Imaging Preparations:

    • Ex vivo brain explants for extended imaging

    • Immobilized larvae for in vivo imaging

    • Isolated primary neurons for detailed subcellular analysis

  • Activity Manipulation:

    • Optogenetic stimulation to trigger neuronal activity

    • Pharmacological treatments (high K+, glutamate) for synchronized activation

    • Tetrodotoxin (TTX) for activity suppression

Analysis Approaches:

  • Colocalization Analysis:

    • Measure bright detail similarity (BDS) scores with synaptic vesicle markers or IFNα

    • Pearson's and Mander's coefficients for quantitative colocalization

    • Object-based colocalization for vesicular structures

  • Trafficking Analysis:

    • Single-particle tracking for vesicle movement

    • Kymograph analysis for directional transport

    • Mean squared displacement for diffusion characteristics

  • Activity-Dependent Dynamics:

    • pHluorin-based reporters to monitor exo-endocytosis cycles

    • Calcium indicators to correlate activity with trafficking

    • Automated vesicle detection and tracking during stimulation

These approaches can reveal how SCAMP5 coordinates autophagy and exosome secretion or regulates synaptic vesicle endocytosis during high neuronal activity in the context of the intact zebrafish nervous system.

How might the function of SCAMP5 in exosome secretion relate to intercellular communication in zebrafish neural circuits and disease states?

Recent discoveries about SCAMP5's role in exosome secretion open exciting research avenues regarding intercellular communication in zebrafish neural circuits:

SCAMP5 promotes Golgi fragmentation and stimulates unconventional secretion of proteins like α-synuclein via exosomes . This function represents a critical cellular mechanism for clearing potentially toxic proteins and may serve as an alternative clearance pathway when autophagy is compromised.

Research Implications for Neural Circuit Communication:

  • Activity-Dependent Exosome Release:

    • SCAMP5 expression increases during high neuronal activity

    • This may trigger activity-dependent exosome release

    • Exosomes could carry signaling molecules that modify postsynaptic function

    • This mechanism might contribute to synaptic plasticity and memory formation

  • Trans-Synaptic Signaling:

    • Exosomes can cross synapses and transfer contents to connected neurons

    • SCAMP5-mediated exosome release might regulate circuit-wide communication

    • Proteins, lipids, and RNAs packaged in exosomes could influence recipient cell function

    • This process could coordinate network-wide responses to activity patterns

  • Disease-Related Protein Spreading:

    • Neurodegenerative disease proteins (α-synuclein, tau, etc.) can spread via exosomes

    • SCAMP5 regulation of exosome secretion might influence disease progression

    • Zebrafish models expressing human disease proteins could test this hypothesis

    • Tracking labeled proteins in vivo could visualize intercellular transfer

Experimental Approaches:

  • Create transgenic zebrafish expressing fluorescently labeled SCAMP5 and exosome markers

  • Use optogenetics to trigger activity in specific neurons while monitoring exosome release

  • Apply high-resolution imaging to track exosome movement between cells

  • Manipulate SCAMP5 levels to assess effects on protein spreading in disease models

  • Perform transcriptomic and proteomic analysis of exosomes from SCAMP5-manipulated neurons

This research direction could reveal how SCAMP5-mediated exosome secretion contributes to both normal circuit function and pathological states in the zebrafish nervous system, with potential implications for human neurological disorders associated with SCAMP5 mutations .

What are the potential applications of SCAMP5 research in zebrafish for developing novel therapeutic approaches for neurodegenerative and neurodevelopmental disorders?

SCAMP5 research in zebrafish offers several promising avenues for therapeutic development:

Therapeutic Target Identification:

  • Pathway Modulation:

    • Targeting the SCAMP5-regulated autophagy-exosome balance

    • Enhancing SCAMP5-mediated exosome secretion to clear toxic proteins

    • Restoring normal synaptic vesicle cycling in disorders with endocytic defects

  • Disease-Specific Approaches:

    • For autism spectrum disorders: Normalizing synaptic transmission during high activity

    • For Parkinson's disease: Enhancing α-synuclein clearance via exosomes

    • For epilepsy: Regulating T-type calcium channels to normalize excitability

Drug Discovery Platform:

Zebrafish SCAMP5 models provide an ideal system for drug discovery due to:

  • High-throughput screening capability:

    • Test thousands of compounds in larvae with fluorescent reporters

    • Assess effects on SCAMP5-dependent processes (vesicle cycling, exosome release)

    • Monitor both efficacy and toxicity simultaneously

  • Phenotypic relevance:

    • Behavioral readouts directly relevant to human disorders

    • Circuit-level changes visible in intact neural systems

    • Development effects observable in real-time

Therapeutic Modalities:

  • Small molecule modulators:

    • Compounds that enhance or inhibit SCAMP5 function

    • Drugs that bypass SCAMP5 deficiency by directly modulating effector pathways

    • Activity-dependent therapeutics that function during high neuronal activity

  • Genetic approaches:

    • Antisense oligonucleotides to modulate SCAMP5 expression

    • Gene therapy to restore SCAMP5 function in deficient states

    • CRISPR-based approaches to correct disease-causing mutations

  • Exosome-based therapeutics:

    • Engineered exosomes guided by SCAMP5 research

    • Loading therapeutic cargoes into the SCAMP5-regulated secretory pathway

    • Targeting specific neural populations based on SCAMP5 expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.