Recombinant Danio rerio Selenoprotein S (sels)

Shipped with Ice Packs
In Stock

Description

Introduction

Selenoprotein S (SelS), also known as VIMP (valosin-containing protein (VCP)-interacting membrane protein), is a selenoprotein implicated in various cellular processes, including endoplasmic reticulum-associated degradation (ERAD), inflammation, and immune response . Selenoproteins contain selenocysteine (Sec), an amino acid with selenium, which is essential for their function . Selenium is incorporated co-translationally in response to a UGA codon, which typically signals translation termination, but instead directs Sec incorporation when a Sec insertion sequence (SECIS) element is present in the mRNA .

Danio rerio, or zebrafish, is a widely used model organism in biological research due to its genetic similarity to humans, transparent embryos, and ease of maintenance . Recombinant SelS refers to SelS that is produced using recombinant DNA technology, where the gene encoding SelS from Danio rerio is expressed in a host organism, such as bacteria or mammalian cells, to produce the protein in large quantities .

Biosynthesis and Regulation

Selenoprotein synthesis is a complex process involving several factors, including selenocysteine tRNA, Sec synthase, and SECIS-binding protein 2 (SBP2) . SBP2 contains three distinct domains: an NH2-terminal domain, a Sec incorporation domain (SID), and a COOH-terminal RNA-binding domain (RBD) . Selenium availability influences the expression of selenoproteins, with increased selenium levels generally leading to higher selenoprotein expression .

Recombinant Production and Applications

Recombinant Danio rerio SelS can be produced in various expression systems, including bacteria, yeast, and mammalian cells . Recombinant SelS can be used for structural studies, functional assays, and drug screening .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
vimp; sels; zgc:136970; Selenoprotein S; SelS; VCP-interacting membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
vimp
Target Protein Sequence
MEAEDGARVRNEDVPPQNQDLSFLQPSVTAFMSEYGWYLLFGCVGVYLLIQHLRKSRSST QTRSSSGSAEAHDVGSVVRRQEALEASRRRMQEEQDARAAEFREKQRMLEEEKRRQKIEM WDSMQEGKSYKGSAKVAQQNTEEAASSSSLRPKTEKKPLRSSGYSPLSGDAGGSCSWRPG RRGPSAGGUG
Uniprot No.

Target Background

Function

This protein is involved in the degradation of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol, where they undergo proteasomal degradation via a ubiquitin-dependent pathway.

Database Links
Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is Selenoprotein S in Danio rerio and how does it compare to mammalian homologs?

Selenoprotein S (gene symbol: selenos) in Danio rerio is a transmembrane protein localized in the endoplasmic reticulum (ER). It belongs to the selenoprotein family, characterized by incorporation of the rare amino acid selenocysteine (Sec). In zebrafish, as in mammals, sels is involved in the degradation process of misfolded proteins in the ER and may have roles in inflammation control .

The protein contains a selenocysteine residue encoded by the UGA codon, which typically signals translation termination. This recoding of UGA is directed by a specific stem-loop structure in the 3' UTR known as the Sec insertion sequence (SECIS) element . Comparative analysis shows conservation of key functional domains between zebrafish and mammalian selenoprotein S, though with species-specific variations that may reflect evolutionary adaptations to different physiological requirements.

What cellular functions has Selenoprotein S been implicated in?

Selenoprotein S functions primarily in:

  • ER-associated degradation (ERAD) of misfolded proteins - serving as a critical component of protein quality control mechanisms

  • Protection against oxidative stress - like other selenoproteins that possess redox-active functions

  • Inflammation regulation - potentially through redox-dependent signaling pathways

  • Cellular response to selenium availability - as its expression is regulated by selenium levels

The antioxidant role is particularly significant as selenoproteins with characterized functions typically operate as oxidoreductases, with the selenocysteine residue positioned in the enzyme active site to perform catalytic redox reactions .

What are the most effective expression systems for recombinant Danio rerio Selenoprotein S?

For successful expression of recombinant Danio rerio Selenoprotein S, several expression systems can be employed, each with distinct advantages:

Mammalian Expression Systems:

  • HEK293 and NIH 3T3 cells have been successfully used to express selenoproteins, including those from Danio rerio

  • These systems contain the necessary selenoprotein synthesis machinery, including SBP2 (SECIS binding protein 2), which is required for selenoprotein synthesis

  • Methodology approach: Construct design should include the native Danio rerio SECIS element in the 3' UTR to ensure proper selenocysteine incorporation. Transfection efficiency can be optimized using lipid-based reagents with typical expression periods of 24-72 hours

Bacterial Expression Systems:

  • Modified E. coli strains co-expressing components of the selenocysteine insertion machinery can be utilized

  • These require co-expression of SPS2 (selenophosphate synthetase 2) and other factors to supply selenophosphate as the selenium donor

  • A common approach involves using the pET expression system with selenocysteine-incorporation-competent E. coli strains supplemented with sodium selenite in the growth medium

How can the SECIS element be optimized for maximum selenoprotein expression?

The SECIS element is crucial for selenocysteine incorporation. Optimization strategies include:

  • Using the authentic Danio rerio SelL SECIS element, which has been demonstrated to support the insertion of selenocysteine in heterologous expression systems

  • Ensuring proper distance between the UGA codon and the SECIS element to facilitate recognition by selenocysteine incorporation machinery

  • Maintaining the stem-loop structure integrity, as mutations in this region can dramatically reduce selenoprotein synthesis

Research indicates that SBP2 binding to SECIS elements is a rate-limiting step in selenoprotein synthesis. The affinity of SBP2 for different SECIS elements varies, which contributes to the hierarchy of selenoprotein expression . Therefore, using SECIS elements with high SBP2 binding affinity can enhance recombinant expression.

How can Selenoprotein S function be studied in the context of ER stress pathways?

Methodological approach for studying Selenoprotein S in ER stress:

  • Induction of ER stress:

    • Treatment with tunicamycin (1-5 μg/mL) or thapsigargin (0.1-1 μM) for 6-24 hours

    • Monitoring canonical ER stress markers (BiP, CHOP, XBP1 splicing) alongside Selenoprotein S expression

  • Knockdown and overexpression experiments:

    • CRISPR-Cas9 editing of the sbp2 gene to disrupt selenoprotein synthesis machinery and observe effects on ER stress responses

    • Transient overexpression using vectors containing the Danio rerio SelS coding sequence with intact SECIS element

  • Proximity labeling approaches:

    • BioID or APEX2 fusion with Selenoprotein S to identify interaction partners during normal and ER stress conditions

    • This can reveal stress-dependent protein associations that may illuminate functional roles

Researchers should note that Selenoprotein S function is intimately connected with selenium availability, and experiments should control for selenium levels to avoid confounding effects on expression and function .

What techniques can be used to study the redox properties of Selenoprotein S?

As a selenoprotein, Selenoprotein S likely possesses redox-active properties. The following methodologies are effective for investigating these properties:

  • Redox state analysis:

    • Alkylation assays using maleimide-PEG compounds to differentiate reduced and oxidized forms

    • In vitro analysis with recombinant protein to determine redox potential using glutathione redox couples

  • Functional redox assays:

    • Hydrogen peroxide challenge followed by viability assessment in cells with normal or altered Selenoprotein S levels

    • Measurement of cellular ROS using fluorescent probes (DCF-DA, MitoSOX) after Selenoprotein S manipulation

  • Selenocysteine oxidation state:

    • Mass spectrometry to identify selenocysteine redox states

    • Similar to analyses performed on other selenoproteins like SelL, which has been shown to form diselenide bonds between selenocysteine residues

Research has shown that selenoproteins expressed in mammalian cells can occur in oxidized forms that are not reducible by DTT, suggesting stable selenocysteine oxidation states that may be functionally relevant .

What controls are essential when studying recombinant Selenoprotein S expression?

For rigorous experimental design, the following controls are essential:

Expression Controls:

  • Cysteine-substituted mutant (Sec→Cys) - to distinguish selenocysteine-dependent functions

  • Truncated protein lacking the SECIS element - to verify SECIS-dependent expression

  • Wild-type protein expressed under selenium-deficient conditions - to assess selenium dependence

Functional Controls:

  • Catalytically inactive mutants (mutations in predicted active site residues)

  • Subcellular localization controls to confirm proper ER membrane insertion

  • Selenoprotein-null background (e.g., sbp2^-/-^) for complementation studies

Selenium Incorporation Verification:

  • Metabolic labeling with ^75^Se-selenite (e.g., 375 nM for 24h) followed by SDS-PAGE and phosphorimager analysis

  • Mass spectrometry to confirm selenocysteine incorporation at the expected position

How should experiments be designed to study Selenoprotein S in the context of oxidative stress?

Oxidative stress experiments require careful design:

  • Stress induction protocols:

    • Hydrogen peroxide (50-500 μM, 1-24h)

    • Paraquat (10-100 μM, 6-48h)

    • High dietary DHA to induce lipid peroxidation-related stress in zebrafish

  • Oxidative damage measurements:

    • TBARS (thiobarbituric acid reactive substances) assay to assess lipid peroxidation

    • Protein carbonylation assays

    • 8-OHdG measurement for DNA oxidation

  • Experimental design considerations:

    • Include selenium-supplemented (e.g., 7 mg/kg in fish diets) and selenium-deficient conditions to assess selenium-dependent protection

    • Compare wild-type with Selenoprotein S-deficient models

    • Monitor expression of other selenoproteins (e.g., using qPCR) as they may compensate for Selenoprotein S deficiency

Research has demonstrated that selenium supplementation can reduce oxidative damage in zebrafish exposed to high DHA diets, indicating an important role for selenoproteins in antioxidant protection .

What are common challenges in achieving proper selenocysteine incorporation and how can they be addressed?

Several technical challenges can hinder successful selenocysteine incorporation:

Challenge 1: Premature termination at UGA codons

  • Solution: Optimize the SECIS element from Danio rerio, which has been shown to successfully direct selenocysteine incorporation in heterologous expression systems

  • Approach: Use constructs with C-terminal tags to select for full-length protein containing successfully incorporated selenocysteine

Challenge 2: Low selenium availability

  • Solution: Supplement expression media with sodium selenite (typically 100-200 nM)

  • Consideration: Higher selenite concentrations can be toxic; titration may be necessary

Challenge 3: Competition between selenocysteine insertion and termination

  • Solution: Co-express SBP2 to enhance selenocysteine incorporation efficiency

  • Approach: In systems where SBP2 function is compromised, consider co-expressing Secisbp2-like, which has been shown to support selective selenoprotein synthesis

Challenge 4: Verification of selenocysteine incorporation

  • Solution: Use mass spectrometry or metabolic labeling with ^75^Se-selenite

  • Methodology: Compare migration patterns of wild-type versus Sec→Cys mutants on non-reducing versus reducing SDS-PAGE to detect potential diselenide bond formation

How can researchers distinguish between selenocysteine and cysteine in functional studies?

Distinguishing selenocysteine from cysteine is critical for understanding selenoprotein-specific functions:

  • Comparative biochemical analysis:

    • Express both wild-type (with selenocysteine) and mutant (with cysteine) proteins

    • Compare enzymatic activities, as Cys mutants of selenoproteins typically show significantly reduced activity

  • pH-dependent activity profiles:

    • Selenocysteine has a lower pKa (~5.2) than cysteine (~8.3), resulting in different activity profiles across pH ranges

    • Measure activity at pH 6.5-7.0 where differences should be most pronounced

  • Differential sensitivity to oxidative inactivation:

    • Selenocysteine-containing proteins typically show greater resistance to oxidative inactivation

    • Challenge with increasing H₂O₂ concentrations and monitor activity retention

  • Mass spectrometry approaches:

    • Analyze the mass difference between selenocysteine (MW: 167.05 Da) and cysteine (MW: 121.16 Da)

    • Look for characteristic selenium isotope patterns in peptide fragments

Research has shown that under selenium deficiency, selenocysteine can be replaced by cysteine in some selenoproteins through the selenocysteine biosynthesis machinery using sulfide instead of selenide to generate thiophosphate .

How does zebrafish Selenoprotein S expression pattern compare across tissues and developmental stages?

Understanding tissue-specific and developmental expression patterns provides insight into function:

Tissue Distribution Pattern:

TissueRelative Expression LevelNotes
LiverHighMajor site of selenoprotein synthesis
MuscleModerateExpression patterns differ from liver
BrainModerateAssociated with neuroprotective functions
PancreasVariableLinked to ER stress responses
GillModerate-highImportant for oxidative stress response

Developmental Expression:

  • Expression begins during early embryogenesis

  • Patterns may follow those of the selenoprotein synthesis machinery, including SBP2

  • Consider using developmental stage-specific qPCR to generate accurate expression profiles

Research on selenoprotein expression in zebrafish has shown tissue-specific patterns, with only certain selenoproteins (e.g., deiodinase type II) showing transcriptional responses to high dietary selenium .

How do zebrafish and human Selenoprotein S differ in structure and function?

Understanding cross-species differences is important for translational research:

Structural Comparison:

  • Core functional domains are conserved between species

  • The selenocysteine residue position is maintained

  • Transmembrane topology shows similar organization with both positioned in the ER membrane

Functional Differences:

  • Regulation patterns may differ, with tissue-specific expression showing species-specific characteristics

  • Response to selenium levels may vary in magnitude between species

  • Interaction partners may differ, affecting participation in specific cellular pathways

Methodological Approach for Comparison:

  • Complementation studies in knockout systems

  • Cross-species immunoprecipitation to identify differential binding partners

  • Heterologous expression to compare trafficking and localization patterns

What are promising approaches for studying Selenoprotein S interactions with other ERAD components?

The role of Selenoprotein S in ER-associated degradation warrants detailed investigation:

Proximity-based Interaction Mapping:

  • BioID or APEX2 fusion proteins to identify proteins in close proximity to Selenoprotein S

  • Split-complementation assays (BiFC) to visualize interactions with predicted partners

  • FRET-based approaches to study dynamic interactions during ER stress

Functional Interaction Studies:

  • Co-immunoprecipitation under varying redox conditions to determine redox-dependent interactions

  • Genetic interaction screens in zebrafish using CRISPR-Cas9 technology

  • Reconstitution of ERAD complexes with recombinant components including Selenoprotein S

Advanced Imaging Approaches:

  • Super-resolution microscopy to visualize Selenoprotein S clusters during ERAD activation

  • Live-cell imaging of fluorescently-tagged Selenoprotein S during ER stress responses

How can researchers effectively study the relationship between selenium availability and Selenoprotein S function?

Selenium availability critically affects selenoprotein function:

Experimental Design Approaches:

  • Controlled dietary studies in zebrafish with defined selenium levels (deficient, adequate, supplemented)

  • Cellular models with selenium depletion/repletion protocols

  • Time-course analyses to determine adaptation to changing selenium levels

Analytical Methods:

  • Quantitative proteomics to measure changes in the entire selenoproteome in response to selenium availability

  • Measurement of selenoprotein hierarchy effects - which selenoproteins are preferentially preserved under limiting conditions

  • Analysis of Selenoprotein S with cysteine substitution under selenium deficiency

Research has demonstrated that under selenium deficiency, SPS2 can utilize sulfide instead of selenide to generate thiophosphate, allowing cysteine to be incorporated instead of selenocysteine in selenoproteins . This mechanism represents an important adaptation to selenium deficiency that may affect interpretation of experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.