Recombinant Danio rerio Short-chain dehydrogenase/reductase family 42E member 1 (sdr42e1)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The zebrafish SDR42E1 protein (UniProt ID: A8DZE7) contains 387 amino acids with conserved SDR motifs, including a catalytic triad (Ser-Tyr-Lys) and NAD(P)H-binding domains. Key functional regions include:

  • Active Site: Hydrophobic interactions with steroid/vitamin D precursors (e.g., 7-dehydrocholesterol) .

  • Transmembrane Localization: Predicted membrane integration for interaction with lipid substrates .

Gene Overview

AttributeValueSource
Gene ID565964 (zebrafish)
Synonymssi:ch211-79l17.4, zgc:123280, HSPC105 homolog
Human OrthologSDR42E1 (OMIM: 616164; UniProt: Q8WUS8)
Chromosomal LocationZebrafish: Chromosome 14; Human: 16p12.3

Evolutionary Conservation

SDR42E1 orthologs are present in:

OrganismGene ID/UniProtConservation (%)Source
Homo sapiensQ8WUS862.65
Mus musculusNP_083001.158.2
Arabidopsis thalianaAT2G3363027.0

Biochemical Functions

  1. Steroid Biosynthesis:

    • Catalyzes oxidation/reduction of steroid precursors (e.g., 3β-hydroxy-Δ⁵-steroids) .

    • Mutations in human SDR42E1 cause oculocutaneous genital syndrome, linked to impaired cholesterol synthesis and connective tissue defects .

  2. Vitamin D Metabolism:

    • Binds 7-dehydrocholesterol and 25-hydroxyvitamin D in molecular docking studies, suggesting a role in skin vitamin D biosynthesis .

  3. Enzymatic Activity:

    SubstrateInteraction StrengthBiological RelevanceSource
    8-DehydrocholesterolHigh (docking score)Vitamin D precursor
    7-DehydrocholesterolModerateVitamin D synthesis pathway
    25-Hydroxyvitamin DLowMetabolite regulation

Experimental Uses

ApplicationDescriptionSource
ELISA/Western BlotDetection of SDR42E1 in zebrafish or human tissues
Antibody ProductionGST-tagged recombinant protein used as antigen for polyclonal/monoclonal antibodies
Enzyme KineticsIn vitro assays to study substrate specificity and cofactor dependency

Genetic Studies

  • Zebrafish Models: Used to study SDR42E1’s role in developmental biology and steroidogenesis .

  • Human Pathology: Identified as a susceptibility gene for connective tissue disorders (e.g., brittle cornea syndrome) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
sdr42e1; si:ch211-79l17.4; zgc:123280; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
sdr42e1
Target Protein Sequence
MEVNRKDNSFLITGGGGYFGFRLACALLKTSSKVVLFDVSPPIQDLPEGLIFMRADIRDY AQVEKAVRGSHCVFHIASYGMSGREQLNRKLIEEVNVKGTENILRACVAHSVPRLIYTST FNVVFGGQEIKNGDESLPYLPLHLHPDHYSRTKSIAEMQVLKANNLALSNSTGVLRTCAL RPAGIYGPGEQRHLPRIVSYIENGIFRFVYGDPDSLVEFVHVDNLVSAHLLAADALTEKQ QCRAAGQAYFISDGRPVNNFEFFRPLVEGLGYSFPTLRLPISMIYFFAFLTEMVHFVVGR IYNFQPLLTRTEVYKTGVTHYFSMRKAREELGYEPKLYDLEDVVQWFQARGHGKKRSRSS IRKLILDVFVVVAFVAVLLSCLPVVGQ
Uniprot No.

Target Background

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic function of sdr42e1 in Danio rerio?

Zebrafish sdr42e1 (short-chain dehydrogenase/reductase family 42E member 1) is predicted to enable oxidoreductase activity, specifically acting on the CH-OH group of donors with NAD or NADP as an acceptor. It functions upstream of or within steroid biosynthetic processes and is predicted to be located in cellular membranes. The gene shows notable expression in female organisms and is orthologous to human SDR42E1 .

Its enzymatic classification (EC 1.1.1.-) indicates it belongs to a family of oxidoreductases that act on the CH-OH group of donors with NAD(+) or NADP(+) as electron acceptors, suggesting a role in redox reactions essential for steroid metabolism .

How is sdr42e1 categorized in terms of protein family and structure?

Sdr42e1 belongs to the short-chain dehydrogenase/reductase (SDR) superfamily, a large group of NAD(P)(H)-dependent oxidoreductases. In zebrafish, it is also known by several synonyms including:

  • si:ch211-79l17.4

  • zgc:123280

  • 3-beta-HSD family protein HSPC105 homolog A

The protein contains characteristic SDR structural motifs including a Rossmann-fold domain for nucleotide binding. SDR family members typically share a common structural scaffold but have diverse substrate specificities, enabling them to participate in various metabolic processes including steroid hormone, prostaglandin, and retinoid metabolism.

What orthologous relationships exist between zebrafish sdr42e1 and other species?

Zebrafish sdr42e1 has identified orthologs across multiple vertebrate species including:

SpeciesGene NameNotable Features
HumanSDR42E1Linked to vitamin D biosynthesis and connective tissue disorders
MouseSdr42e1Similar metabolic functions to human ortholog
RatSdr42e1Conserved oxidoreductase functionality
Turquoise killifishsdr42e1Teleost-specific conservation
Tropical clawed frogsdr42e1Amphibian ortholog
PigSDR42E1Mammalian conservation
Domestic cattleSDR42E1Conserved across agricultural species
DogSDR42E1Conserved across companion animals

This high degree of conservation across vertebrates suggests essential biological functions .

What expression systems are most effective for producing recombinant Danio rerio sdr42e1?

For recombinant expression of zebrafish sdr42e1, researchers should consider these methodological approaches:

  • Bacterial expression systems: E. coli BL21(DE3) with pET vectors containing codon-optimized sdr42e1 sequences can provide moderate yields, though membrane localization may complicate purification.

  • Insect cell systems: Baculovirus-infected Sf9 or High Five cells often provide superior folding for eukaryotic membrane-associated proteins like sdr42e1.

  • Yeast expression: Pichia pastoris systems can be advantageous for scaling up production while maintaining post-translational modifications.

Optimization strategies should focus on:

  • Including appropriate affinity tags (His6, GST) for purification

  • Adjusting induction parameters (temperature, IPTG concentration)

  • Incorporating solubility-enhancing fusion partners like MBP or SUMO

  • Using detergents appropriate for membrane-associated proteins during lysis and purification

How can I design CRISPR-Cas9 knockouts of sdr42e1 in zebrafish models?

When designing CRISPR-Cas9 knockout strategies for sdr42e1 in zebrafish, consider these methodological approaches:

  • Target selection: Design sgRNAs targeting early exons (particularly exon 3) to maximize disruption probability. The Ensembl ID ENSDARG00000098838 can be used to access the complete genomic sequence for target design .

  • Guide RNA design: Utilize zebrafish-specific CRISPR design tools that account for genome-specific features. Aim for guides with minimal off-target effects and high on-target efficiency scores.

  • Validation strategy: Plan for genotyping using methods similar to those employed for epha4a/b mutants, which utilized PCR amplification followed by sequencing to confirm deletions .

  • Phenotypic analysis: Implement comprehensive behavioral analysis similar to approaches used for epha4a mutants, including EthoVision XT software for swimming behavior assessment at larval stages (8 dpf) to detect potential motor defects .

What are effective methods for measuring sdr42e1 enzymatic activity in vitro?

For measuring the oxidoreductase activity of recombinant sdr42e1, researchers should implement these methodological approaches:

  • Spectrophotometric assays: Monitor NAD(P)H consumption or production at 340 nm in real-time to quantify reaction kinetics. Standard reaction conditions should include:

    • Buffer: 50 mM Tris-HCl (pH 7.4) or phosphate buffer

    • Cofactor: 0.5 mM NAD+ or NADP+

    • Temperature: 28°C (zebrafish physiological relevance)

    • Potential substrates: Test steroid precursors, focusing on vitamin D metabolites based on recent discoveries

  • LC-MS analysis: For precise substrate identification and product characterization, utilize liquid chromatography-mass spectrometry to:

    • Identify conversion of potential steroid substrates

    • Quantify reaction products

    • Determine enzyme specificity

  • Controls and validation:

    • Include catalytically inactive mutant versions (e.g., mutations in predicted catalytic sites)

    • Compare activity with both human and zebrafish orthologs

    • Test inhibition with known SDR family inhibitors

How does sdr42e1 contribute to steroid biosynthesis pathways in zebrafish?

Zebrafish sdr42e1 is predicted to function in steroid biosynthetic processes, although specific mechanistic details require further elucidation . Based on recent findings in human studies, sdr42e1 likely plays a crucial role in the following pathways:

  • Cholesterol metabolism: Human studies indicate SDR42E1 mutations are associated with low cholesterol levels, suggesting the enzyme may participate in cholesterol biosynthesis or regulation . In zebrafish models, this could manifest as:

    • Altered cholesterol levels during development

    • Disrupted steroid hormone precursor availability

    • Developmental abnormalities related to steroid deficiency

  • Vitamin D biosynthesis: Recent research indicates SDR42E1 is involved in vitamin D metabolism pathways . Transcriptomic analysis of SDR42E1-depleted models showed a 1.6-fold disruption in steroid biosynthesis pathways. In zebrafish, this suggests sdr42e1 may catalyze specific hydroxylation or oxidation steps in the conversion of cholesterol derivatives to active vitamin D metabolites.

  • Steroid hormone production: The enzyme's classification and predicted function suggest involvement in the synthesis or modification of steroid hormones that regulate development and reproduction in zebrafish.

What protein interaction networks involve sdr42e1 in Danio rerio?

While comprehensive protein interaction data specific to zebrafish sdr42e1 is limited in the provided search results, potential interactions can be inferred from:

  • Predictive pathway membership: As an enzyme involved in steroid biosynthesis, sdr42e1 likely interacts with:

    • Upstream enzymes supplying substrates (sterol transport proteins, other dehydrogenases)

    • Downstream enzymes that further modify its products

    • Regulatory proteins that modulate its activity

  • Membrane localization: The predicted membrane localization of sdr42e1 suggests potential interactions with:

    • Membrane transport proteins for substrate uptake

    • Lipid raft components

    • Signaling complexes at membrane interfaces

  • Developmental context: The association of sdr42e1 with development suggests potential interactions with developmental signaling pathways. The search results indicate a possible relationship with EphA4 signaling, as both epha4a/b and sdr42e1 are mentioned in zebrafish research contexts , though direct interaction evidence is not provided.

How does sdr42e1 function relate to developmental processes in zebrafish?

While direct evidence linking zebrafish sdr42e1 to specific developmental processes is limited in the provided search results, several important connections can be drawn:

  • Sexual development: The human ortholog SDR42E1 has been linked to disorders of sexual development, including micropenis, hypospadias, and cryptorchidism . In zebrafish, this suggests sdr42e1 may play a role in:

    • Gonadal development and differentiation

    • Sex steroid biosynthesis and signaling

    • Sexual dimorphism establishment

  • Connective tissue development: Mutations in human SDR42E1 are associated with features of brittle cornea syndrome and other connective tissue abnormalities . This suggests zebrafish sdr42e1 may influence:

    • Extracellular matrix formation and maintenance

    • Collagen biosynthesis and stability

    • Tissue integrity during development

  • Behavioral development: While not directly established for sdr42e1, the search results indicate zebrafish models with mutations in developmental pathways (epha4a) show abnormal swimming behaviors . If sdr42e1 influences neurosteroid production, it could potentially affect:

    • Central pattern generator (CPG) development

    • Motor neuron function

    • Left-right coordination of swimming movements

What human disease models can be studied using zebrafish sdr42e1?

Zebrafish sdr42e1 models can provide valuable insights into several human disease conditions:

  • Rare connective tissue disorders: A homozygous missense mutation (c.461G > A; p.Arg154Gln) in human SDR42E1 has been associated with an oculocutaneous genital syndrome featuring:

    • Thinning of the cornea

    • Blue sclera

    • Keratoconus

    • Hyperelasticity of the skin

    • Joint hypermobility

    • Muscle weakness

    • Hearing loss

    • Dental abnormalities

  • Disorders of sexual development: The same SDR42E1 mutation was linked to genital abnormalities including:

    • Micropenis

    • Hypospadias

    • Cryptorchidism

  • Vitamin D metabolism disorders: Recent research has implicated SDR42E1 in vitamin D biosynthesis , suggesting zebrafish models could help study:

    • Vitamin D deficiency mechanisms

    • Genetic determinants of vitamin D metabolism

    • Developmental impacts of disrupted vitamin D signaling

To effectively model these conditions, CRISPR-Cas9 gene editing can generate zebrafish carrying equivalent mutations to those found in human patients.

How do mutations in sdr42e1 affect cholesterol metabolism in zebrafish models?

Based on findings from human studies, mutations in zebrafish sdr42e1 likely impact cholesterol metabolism in several ways:

  • Reduced cholesterol levels: Human patients with SDR42E1 mutations showed abnormally low cholesterol levels , suggesting zebrafish models would exhibit:

    • Decreased total body cholesterol

    • Altered distribution of cholesterol in tissues

    • Disrupted cholesterol-dependent processes

  • Steroid hormone deficiencies: As cholesterol is the precursor for all steroid hormones, sdr42e1 mutations would likely lead to:

    • Reduced production of sex steroids (consistent with genital abnormalities observed in humans)

    • Altered stress hormone synthesis

    • Developmental delays in steroid-dependent processes

  • Membrane composition changes: Cholesterol is crucial for membrane structure and function, therefore sdr42e1 mutations might affect:

    • Cell membrane fluidity

    • Lipid raft formation

    • Membrane protein organization and function

When designing experiments to assess these effects, researchers should measure:

  • Whole-body and tissue-specific cholesterol levels

  • Expression of cholesterol biosynthesis genes

  • Steroid hormone profiles

  • Membrane properties in affected tissues

What phenotypic assays are most informative when studying sdr42e1 mutant zebrafish?

Based on the known functions and disease associations, these phenotypic assays would provide the most valuable data when studying sdr42e1 mutant zebrafish:

  • Structural and developmental assessments:

    • Microscopic examination of connective tissues (particularly cornea and skin) for elasticity and integrity defects

    • Skeletal development analysis (similar to epha4a mutants that develop scoliosis)

    • Gonadal development and sexual differentiation tracking

  • Behavioral assessments:

    • Swimming pattern analysis using EthoVision XT software (measuring distance, velocity, turning angles)

    • Startle response testing with high-speed video microscopy to detect left-right coordination defects

    • Calcium imaging in motor neurons using Tg(elavl3:GAL4; UAS:GCaMP) to assess central pattern generator functionality

  • Biochemical and molecular assessments:

    • Cholesterol level quantification

    • Steroid hormone profiling (particularly sex hormones and vitamin D metabolites)

    • Transcriptomic analysis to identify dysregulated pathways (similar to the 1.6-fold disruption in steroid biosynthesis observed in human studies)

How can transcriptomics approaches help elucidate sdr42e1 function in zebrafish?

Advanced transcriptomic approaches offer powerful tools for understanding sdr42e1 function:

  • RNA-Seq comparison of wildtype vs. mutant zebrafish:

    • Recent human studies demonstrated that SDR42E1 depletion caused a 1.6-fold disruption in steroid biosynthesis pathways

    • Similar approaches in zebrafish could identify:

      • Dysregulated gene networks

      • Compensatory mechanisms

      • Tissue-specific effects

  • Single-cell RNA sequencing (scRNA-seq):

    • Enables cell-type specific resolution of sdr42e1 effects

    • Can identify vulnerable cell populations

    • Provides developmental trajectories affected by sdr42e1 mutation

  • Temporal transcriptomics:

    • Comparing gene expression at different developmental stages

    • Identifying critical windows where sdr42e1 function is most essential

    • Mapping the progression of molecular changes preceding phenotypic manifestations

Implementation strategy should include:

  • Sampling multiple tissues (especially those expressing sdr42e1)

  • Multiple developmental timepoints

  • Integration with proteomics and metabolomics data

What advanced techniques can determine the precise catalytic function of sdr42e1?

Defining the exact catalytic function of sdr42e1 requires sophisticated biochemical approaches:

  • Metabolomics profiling:

    • Untargeted metabolomics to identify accumulated substrates and depleted products in sdr42e1 mutants

    • Targeted metabolomics focusing on steroid pathway intermediates and vitamin D metabolites

    • Stable isotope labeling to track metabolic flux through pathways involving sdr42e1

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of purified recombinant sdr42e1

    • Co-crystallization with potential substrates or inhibitors

    • Molecular docking studies to predict substrate binding

  • Activity-based protein profiling:

    • Using chemical probes that bind to active SDR family members

    • Identifying the specific cellular contexts where sdr42e1 is catalytically active

    • Comparing activity profiles across different developmental stages

These approaches should be integrated with genetic models where key catalytic residues are mutated to confirm substrate identification and reaction mechanisms.

How might sdr42e1 function in emerging research areas like central pattern generator (CPG) development?

While direct evidence linking sdr42e1 to CPG development is not present in the search results, intriguing connections can be explored:

  • Neurosteroid modulation of CPGs:

    • If sdr42e1 produces neurosteroids, it could influence CPG function

    • Research direction: Compare calcium imaging patterns in spinal motor neurons between wildtype and sdr42e1 mutants using techniques described for epha4a studies

    • Hypothesis: Sdr42e1 mutations might disrupt the alternating activation pattern between left and right motor neurons

  • Connection to EphA4 signaling:

    • Search results show epha4a mutant zebrafish exhibit abnormal left-right coordination and swimming patterns

    • Research direction: Investigate potential regulatory relationships between sdr42e1 and EphA4 signaling

    • Approach: Double mutant studies (sdr42e1 and epha4a) to assess potential genetic interactions

  • Vitamin D signaling in neural development:

    • Recent findings connect SDR42E1 to vitamin D biosynthesis

    • Vitamin D has known roles in neural development

    • Research direction: Evaluate CPG development and function in sdr42e1 mutants supplemented with vitamin D metabolites

    • Hypothesis: Vitamin D supplementation might rescue potential CPG defects in sdr42e1 mutants

A multidisciplinary approach combining electrophysiology, calcium imaging, behavioral analysis, and metabolite supplementation would best address these emerging research questions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.