Recombinant Danio rerio Solute carrier family 25 member 34 (slc25a34)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

The recombinant slc25a34 protein is produced via heterologous expression in E. coli, followed by affinity chromatography purification. Critical production parameters include:

  • Reconstitution: Requires centrifugation prior to resuspension to prevent aggregation .

  • Stability: Repeated freeze-thaw cycles degrade the protein; working aliquots stored at 4°C retain functionality for ≤1 week .

  • Applications: Suitable for ELISA, Western blotting, and functional assays investigating mitochondrial transport mechanisms .

Role in Mitochondrial Transport

As a member of the SLC25 family, slc25a34 is hypothesized to shuttle metabolites across the mitochondrial inner membrane. While its specific substrate remains unconfirmed, phylogenetic studies suggest homology to yeast oxaloacetate carriers (Oacp1), which regulate leucine biosynthesis and energy metabolism . In mammals, SLC25A34 may influence lipid and glucose homeostasis, as murine knockout models exhibit dysregulated hepatic energy metabolism .

Evolutionary Context

The SLC25 family likely originated from ancient transposons, with structural conservation across species. Zebrafish slc25a34 shares pseudo-symmetrical transmembrane helices ("mito_carr" and "Solcar" domains) critical for alternating-access transport mechanisms observed in ADP/ATP carriers .

Key Research Findings

  • Knockout Models: Murine Slc25a34 deletion disrupts hepatic lipid and glucose regulation, suggesting conserved metabolic roles in vertebrates .

  • Structural Analysis: The protein’s central cavity, lined with conserved residues, likely facilitates substrate binding and conformational changes during transport .

  • Evolutionary Link: SLC25 transporters share ancestral ties with transposases, highlighting their evolutionary adaptability .

Challenges and Future Directions

Despite progress, slc25a34’s exact physiological substrate and regulatory mechanisms remain uncharacterized. Future studies could leverage zebrafish models to explore its role in developmental biology or metabolic diseases. Additionally, cryo-EM or X-ray crystallography may resolve its tertiary structure, enabling targeted drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format preferences. Please indicate your requirements in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. To ensure optimal product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc25a34; zgc:65857; Solute carrier family 25 member 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a34
Target Protein Sequence
MNSAFSGPSSPTPGPSPPRPPLWPPLDFGLGALACCGACVFTNPLEVVKTRLQLQGELRA RGSYRRLYRGVLQALWVVGRTDGLRGLQKGLTAALLYQGLMNGLRLGSYAQMQAAGVTDG PCCSLIAGAAAGALGAFIASPAYLVKTHLQAQTVAAIAVGHQHNHQGMSSALVSIYRREG VCGLWRGVNGAVPRVMVGSATQLATFSSAKDWITHTQWFSPLSSLNTLCAAVMSGVAVSI IMTPFDVISTRLYNQPVDQFKQGRLYCGFVDCLLKVCAAEGVLGLYKGMTPVFVRLAPHT TLSMLLWDVLRQRALPYTH
Uniprot No.

Target Background

Database Links

KEGG: dre:393552

UniGene: Dr.28444

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is slc25a34 and what is its biological function in Danio rerio?

Solute carrier family 25 member 34 (slc25a34) is a protein encoded by the slc25a34 gene in zebrafish (Danio rerio). As a member of the solute carrier family 25, it likely functions as a mitochondrial carrier protein involved in the transport of molecules across mitochondrial membranes. The protein consists of 319 amino acids with a specific sequence that includes multiple transmembrane domains characteristic of mitochondrial carriers . Functionally, slc25a34 may participate in metabolic pathways that influence cellular energy production, though specific substrates and precise mechanisms remain under investigation in the research community.

What are the molecular characteristics of recombinant slc25a34 protein?

Recombinant Danio rerio slc25a34 protein is characterized by a full-length sequence of 319 amino acids. The amino acid sequence begins with MNSAFSGPSS and contains multiple hydrophobic regions that likely form transmembrane domains for substrate transport across membranes . The protein has a UniProt accession number of Q6PH61 and is also known by the ORF name zgc:65857 . When produced recombinantly, the protein is typically supplied in a Tris-based buffer with 50% glycerol to maintain stability during storage and experimental use .

What expression systems are suitable for producing recombinant slc25a34?

For producing recombinant slc25a34, several expression systems can be employed based on experimental requirements. Bacterial systems (E. coli) offer high yield but may not provide optimal post-translational modifications. Insect cell systems (Sf9, High Five) often provide a balance between proper protein folding and reasonable yield. Mammalian cell systems (HEK293, CHO) offer the most native-like post-translational modifications but with potentially lower yields. The choice depends on the intended use of the protein, with structural studies often requiring highly purified protein from bacterial systems, while functional studies may benefit from protein expressed in eukaryotic systems that preserve native conformation and modifications .

What are the optimal storage conditions for recombinant slc25a34 protein?

Recombinant slc25a34 protein should be stored at -20°C for regular use, or at -80°C for extended storage periods to maintain optimal activity and stability . The protein is typically provided in a Tris-based buffer containing 50% glycerol, which helps prevent protein denaturation during freeze-thaw cycles . For working with the protein, it's recommended to prepare small aliquots to avoid repeated freeze-thaw cycles which can compromise protein integrity. Working aliquots can be stored at 4°C for up to one week, while maintaining viability for experimental procedures . Researchers should avoid repeated freezing and thawing as this significantly impacts protein stability and experimental reproducibility .

How can I optimize ELISA protocols using recombinant slc25a34?

For optimizing ELISA protocols with recombinant slc25a34, begin with antibody selection and validation to ensure specificity against the zebrafish protein. Coating concentration is critical—start with 1-5 μg/ml of capture antibody in carbonate buffer (pH 9.6) overnight at 4°C. For blocking, use 2-5% BSA or milk protein in PBS for 1-2 hours at room temperature. When using the recombinant protein as a standard, prepare a serial dilution ranging from 0.1-1000 ng/ml to establish a calibration curve. Detection sensitivity can be enhanced by using streptavidin-HRP conjugates with TMB substrate and monitoring the reaction kinetics carefully. Temperature control is essential throughout the protocol, with all reactions ideally performed at 20-25°C for consistent results .

What are the challenges in purifying active recombinant slc25a34?

Purifying active recombinant slc25a34 presents several challenges due to its mitochondrial membrane protein characteristics. The hydrophobic transmembrane domains can cause protein aggregation during expression and purification processes. Researchers should employ gentle detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration to solubilize the protein while preserving its native conformation. Affinity purification using carefully positioned tags is recommended, with His-tags being particularly effective when placed at the N-terminus to avoid interfering with protein function. Maintaining protein stability during purification requires buffer optimization with glycerol (10-20%) and specific lipids that mimic the mitochondrial membrane environment .

How can slc25a34 be used in zebrafish developmental studies?

Recombinant slc25a34 can serve as a valuable tool in zebrafish developmental studies through multiple approaches. Researchers can use the purified protein to generate highly specific antibodies for immunohistochemical detection of endogenous slc25a34 expression patterns across different developmental stages. These antibodies enable precise temporal and spatial mapping of protein localization, particularly in mitochondria-rich tissues. Additionally, the recombinant protein can be employed in binding assays to identify interaction partners that may reveal developmental signaling pathways. For functional studies, researchers should consider microinjecting mRNA encoding tagged versions of slc25a34 into zebrafish embryos at the 1-2 cell stage, allowing for visualization of protein localization during early development using confocal microscopy .

What techniques are effective for studying slc25a34 transport function?

To study the transport function of slc25a34, researchers should consider reconstituting the purified recombinant protein into liposomes or nanodiscs that mimic the mitochondrial membrane environment. This reconstitution approach allows for controlled assessment of transport kinetics using radioactively or fluorescently labeled potential substrates. The transport assay typically involves measuring substrate uptake over time while varying external conditions such as pH, temperature, and competing substrates. Patch-clamp electrophysiology on isolated mitochondria or reconstituted membranes can provide direct measurements of transport-associated currents. For higher throughput screening, fluorescence-based assays using potential substrates conjugated to pH-sensitive fluorophores can detect transport-induced pH changes within liposomes .

How does slc25a34 compare structurally and functionally to mammalian orthologs?

Structural and functional comparison between zebrafish slc25a34 and its mammalian orthologs reveals important evolutionary relationships. Sequence alignment analysis shows conservation of key functional domains, particularly in the transmembrane regions and substrate binding sites. The zebrafish protein shares approximately 65-75% amino acid identity with human and mouse orthologs, with higher conservation in the transmembrane domains than in the soluble loop regions. Functional studies suggest similar substrate specificity across species, though kinetic parameters may differ. These differences can be leveraged to understand species-specific metabolic adaptations. The table below summarizes key comparative features:

FeatureZebrafish slc25a34Human SLC25A34Mouse Slc25a34
Amino Acid Length319304308
Transmembrane Domains6 predicted6 predicted6 predicted
Major Expression SitesMultiple tissuesHeart, brain, liverHeart, brain, kidney
Subcellular LocalizationMitochondriaMitochondriaMitochondria
Known SubstratesUnder investigationUnder investigationUnder investigation

This comparative analysis helps researchers determine whether zebrafish models can effectively translate to human studies .

What controls should be included when using recombinant slc25a34 in binding assays?

When designing binding assays with recombinant slc25a34, several controls are essential for result validation. First, include a denatured protein control (heat-treated at 95°C for 10 minutes) to distinguish specific from non-specific binding. Second, employ a competitive binding control using excess unlabeled potential substrates to confirm binding site specificity. Third, utilize a structurally similar but functionally distinct protein from the same solute carrier family (such as slc25a33) as a negative control to verify binding specificity to slc25a34. Fourth, include a gradient of binding conditions (pH 6.5-8.0, salt concentrations 50-250mM) to identify optimal parameters. Finally, apply site-directed mutagenesis to create variants with alterations in predicted binding sites, serving as functional controls to map interaction domains .

How can I design knockdown/knockout experiments to study slc25a34 function in zebrafish?

For studying slc25a34 function through genetic manipulation, researchers have several approaches. Morpholino-based knockdown offers transient reduction in protein expression by designing morpholinos targeting the translation start site or splice junctions of slc25a34 mRNA. Typically, 1-4 ng of morpholino is injected at the 1-2 cell stage. For more permanent genetic modifications, CRISPR/Cas9 technology is preferred, with guide RNAs designed to target conserved regions within the slc25a34 coding sequence, particularly within the first few exons. Target validation requires sequencing verification of induced mutations and western blot analysis using antibodies against recombinant slc25a34 to confirm protein reduction. Rescue experiments involving co-injection of morpholino-resistant slc25a34 mRNA are crucial to verify phenotype specificity. Phenotypic analysis should examine mitochondrial function through assays such as Seahorse metabolic flux analysis, mitochondrial membrane potential measurements, and in vivo imaging of labeled mitochondria .

What techniques can detect interactions between slc25a34 and other mitochondrial proteins?

Several complementary techniques can effectively detect interactions between slc25a34 and other mitochondrial proteins. Co-immunoprecipitation using antibodies against recombinant slc25a34 can pull down interacting proteins from zebrafish mitochondrial extracts, with subsequent mass spectrometry identification of binding partners. Proximity ligation assays offer in situ visualization of protein interactions within intact mitochondria, requiring antibodies against both slc25a34 and suspected interaction partners. Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) approaches involve creating fusion proteins with luminescent/fluorescent tags to detect interactions in live cells. For more direct physical characterization, microscale thermophoresis using fluorescently labeled recombinant slc25a34 can measure binding affinities with potential partners. Crosslinking mass spectrometry combines chemical crosslinking with mass spectrometry to map interaction interfaces at amino acid resolution .

How should researchers normalize data when comparing slc25a34 expression across different tissues?

When comparing slc25a34 expression across different zebrafish tissues, proper normalization is crucial for accurate interpretation. Researchers should employ multiple reference genes (such as β-actin, ef1α, and rpl13a) rather than a single housekeeping gene, as expression stability varies across tissues. Geometric averaging of multiple reference genes using algorithms like geNorm or NormFinder provides more reliable normalization factors. For protein-level studies, total protein normalization using Ponceau S or Coomassie staining offers advantages over single reference proteins like β-actin. When analyzing subcellular fractions, normalization to mitochondrial markers (such as VDAC or COX IV) is essential since slc25a34 is a mitochondrial protein. For developmental studies, researchers should consider stage-specific reference genes, as standard housekeeping genes may fluctuate during development. Finally, absolute quantification using standard curves generated with recombinant slc25a34 protein can provide concentration values independent of reference genes .

How can researchers address data inconsistencies in slc25a34 functional studies?

When confronting data inconsistencies in slc25a34 functional studies, researchers should implement a systematic troubleshooting approach. First, verify protein integrity through size-exclusion chromatography and thermal stability assays, as recombinant slc25a34 may aggregate or denature during experimental procedures. Second, examine buffer composition effects, particularly detergent concentration and lipid content, which significantly impact membrane protein function. Third, consider post-translational modifications by comparing protein from different expression systems, as these modifications can alter transport activity. Fourth, validate antibody specificity using western blots against tissues from slc25a34 knockout models. For transport assays, researchers should systematically vary protein-to-lipid ratios in reconstitution experiments, as improper ratios can lead to inconsistent activity measurements. Additionally, test for substrate purity and stability using analytical techniques like HPLC prior to functional assays. Finally, examine biological variability by increasing sample sizes and including biological replicates from different batches of recombinant protein .

How might slc25a34 contribute to understanding mitochondrial disease models in zebrafish?

Recombinant slc25a34 offers significant potential for advancing zebrafish models of mitochondrial diseases. Researchers can develop transgenic zebrafish lines expressing mutant forms of slc25a34 that mimic human disease variants, allowing in vivo assessment of pathophysiological mechanisms. The recombinant protein can be used to generate high-affinity antibodies for tracking altered expression and localization patterns in disease states. In vitro transport assays using purified protein can identify substrate transport deficiencies associated with specific mutations. Additionally, researchers can conduct high-throughput screens using zebrafish embryos with slc25a34 mutations to identify small molecules that rescue mitochondrial function, potentially revealing therapeutic approaches. The transparency of zebrafish embryos enables real-time visualization of mitochondrial dynamics when combined with fluorescent tags on slc25a34, providing insight into disease progression that would be difficult to achieve in mammalian models .

What are the potential applications of slc25a34 in comparative evolutionary studies?

The recombinant slc25a34 protein from zebrafish presents valuable opportunities for evolutionary studies across vertebrate lineages. Researchers can compare substrate specificity and transport kinetics between recombinant slc25a34 proteins from different species (zebrafish, mammals, birds, reptiles) to trace the evolution of mitochondrial transport mechanisms. Sequence analysis combined with functional characterization of recombinant proteins can identify conserved residues essential for function versus species-specific adaptations. The table below outlines an experimental framework for evolutionary studies:

Research ApproachMethodologyExpected Outcome
Phylogenetic AnalysisSequence comparison across vertebratesEvolutionary relationships of SLC25A34
Structural ConservationHomology modeling based on recombinant proteinIdentification of conserved structural elements
Functional ConservationTransport assays with orthologsSpecies-specific substrate preferences
Expression Pattern AnalysisImmunohistochemistry in multiple speciesTissue-specific adaptations
Adaptive Evolution AnalysisdN/dS ratio calculation at codon levelSites under positive selection

This comparative approach can reveal how mitochondrial transport mechanisms have adapted to different physiological demands across vertebrate evolution .

How can recombinant slc25a34 contribute to understanding zebrafish immunity?

Recombinant slc25a34 can provide insights into the relationship between mitochondrial function and immune responses in zebrafish. Researchers can use the purified protein to investigate interactions with immune signaling proteins through co-immunoprecipitation and mass spectrometry approaches. The protein can serve as an antigen for generating antibodies to track endogenous expression changes during immune challenges, such as bacterial or viral infections. Additionally, studies combining slc25a34 knockdown/knockout with immune challenges can reveal its role in mitochondrial adaptations during immune responses. The recombinant protein can also be used in binding assays to identify potential immunomodulatory molecules that interact with slc25a34, affecting mitochondrial function during inflammation. Since V(D)J recombination occurs in zebrafish oocytes expressing high levels of RAG-RNA, researchers might explore potential connections between mitochondrial carriers like slc25a34 and the energetic requirements of immune system development .

What purification strategies yield the highest activity for recombinant slc25a34?

Obtaining high-activity recombinant slc25a34 requires optimized purification strategies tailored to this mitochondrial carrier protein. The most effective approach begins with expression in eukaryotic systems like insect cells (Sf9) that provide appropriate membrane insertion machinery. For extraction, researchers should use mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% for solubilization, followed by reduction to 0.05% in purification buffers. Affinity chromatography using a Twin-Strep tag produces superior results compared to His-tags, as it allows gentler elution conditions with minimal impact on protein activity. Size exclusion chromatography as a final polishing step separates monomeric active protein from aggregates. Throughout purification, maintaining a lipid environment with cardiolipin (0.01-0.05%) helps preserve native conformation. Buffer composition should include stabilizing agents like glycerol (10%), reducing agents like 1mM DTT, and protease inhibitors. Activity assessment at each purification stage through transport assays helps identify steps that compromise function .

How can isothermal titration calorimetry be optimized for studying slc25a34 substrate binding?

Isothermal titration calorimetry (ITC) for studying substrate binding to recombinant slc25a34 requires specific optimization strategies. Researchers should first ensure protein stability in the ITC buffer by conducting pre-experiment thermal stability assays. The optimal protein concentration range is typically 20-50 μM in the cell, with potential substrate concentrations in the syringe at 10-20 times higher. For membrane proteins like slc25a34, incorporation into nanodiscs rather than detergent micelles provides a more native-like environment for binding studies. Temperature selection is crucial—typically 25°C offers a good balance between signal strength and protein stability. Control experiments must include buffer-into-buffer, buffer-into-protein, and substrate-into-buffer titrations to account for dilution and mixing heats. Data analysis should employ models that account for potential multiple binding sites, as slc25a34 may have several substrate interaction sites with different affinities. Researchers should also consider competition experiments with known mitochondrial carrier substrates to identify binding site overlap .

What considerations are important when designing antibodies against recombinant slc25a34?

When designing antibodies against recombinant slc25a34, several considerations ensure specificity and utility across applications. Epitope selection is critical—researchers should target unique, surface-exposed regions of the protein while avoiding transmembrane domains. Bioinformatic analysis comparing zebrafish slc25a34 with other family members helps identify unique regions to minimize cross-reactivity. For generating polyclonal antibodies, using recombinant protein fragments (50-150 amino acids) rather than synthetic peptides often produces antibodies recognizing multiple epitopes, improving detection sensitivity. When developing monoclonal antibodies, screening against both native and denatured protein identifies clones useful for different applications (immunoprecipitation versus western blotting). Validation should include western blots comparing wild-type to slc25a34 knockdown/knockout tissues, immunofluorescence with appropriate subcellular markers, and pre-absorption controls. For cross-species applications, targeting conserved epitopes between zebrafish and mammalian orthologs extends antibody utility to comparative studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.