Recombinant Danio rerio Solute carrier family 25 member 36-A (slc25a36a)

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Properties

slc25a36a belongs to the mitochondrial carrier family (SLC25), which facilitates nucleotide transport across inner mitochondrial membranes. While direct functional data for the zebrafish protein is limited, homology to human SLC25A36 suggests analogous roles:

Transport Mechanism

  • Substrates: Likely transports pyrimidine (deoxy)nucleotides (e.g., cytosine, uracil, thymine) via uniport or antiport mechanisms, as demonstrated for human SLC25A36 .

  • Inhibition: Sensitive to mercurial compounds and mitochondrial carrier inhibitors .

Mitochondrial Localization

  • Targeted to mitochondria, as shown for human SLC25A33 and SLC25A36 .

Pathway Involvement

  • Integral to mitochondrial DNA/RNA synthesis by regulating nucleotide flux .

Biochemical Studies

Recombinant slc25a36a enables functional assays, such as:

  • Liposome Reconstitution: Assess transport activity in vitro .

  • Kinetic Analysis: Determine substrate specificity and transport rates .

Zebrafish as a Model Organism

  • Renal and Metabolic Studies: Zebrafish larvae with functional pronephrons are used to study transporter-mediated drug clearance and excretion .

  • Genetic Bottlenecks: Laboratory zebrafish strains exhibit reduced genetic diversity, necessitating strain-specific validation .

Comparative Analysis

FeatureZebrafish slc25a36aHuman SLC25A36
Substrate RangeInferred (pyrimidines)Cytosine, uracil, thymine
Transport ModeLikely uniport/antiportUniport and antiport
Mitochondrial RoleDNA/RNA metabolismDNA/RNA synthesis

Production and Handling

Recombinant slc25a36a is commercially available in different forms:

ParameterDetailsSource
FormLiquid or lyophilized powder
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability
Storage- Short-term: 4°C
- Long-term: -20°C/-80°C
Endotoxin Levels<1.0 EU/μg (for mammalian cell-expressed variants)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc25a36a; si:dkeyp-90g12.1; zgc:92447; Solute carrier family 25 member 36-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a36a
Target Protein Sequence
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTFYISEVQLSTVNGASVARMA PPGPLHCLKLILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSTSKEKLNNVFDPDSTQV HMLSAGLAGFTAITATNPIWLIKTRLQLDARNRGERRMSAFECVRRVYQSDGLRGFYRGM SASYAGISETVIHFVIYESIKRKLIEHKANSNMDDEDESVKDASDFVGMMLAAATSKTCA TSIAYPHEVIRTRLREEGSKYRSFFQTLNMVFREEGYRALYRGLTTHLVRQIPNTAIMMC TYELVVYLLNG
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of slc25a36a in zebrafish?

Based on homology with human SLC25A36, zebrafish slc25a36a primarily functions as a mitochondrial transport protein that facilitates the movement of pyrimidine nucleotides across the inner mitochondrial membrane. Research indicates that this protein is crucial for mitochondrial DNA and RNA synthesis and breakdown, transporting cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates through both uniport and antiport mechanisms . Unlike its close family member SLC25A33, slc25a36a can transport nucleoside monophosphates in addition to di- and triphosphates, suggesting a broader substrate specificity profile in nucleotide metabolism .

How is slc25a36a structurally classified and what domains characterize this protein?

While specific domain information for zebrafish slc25a36a is limited in the provided search results, we can infer from human SLC25A36 data that it belongs to the mitochondrial carrier family featuring characteristic domains. These typically include multiple transmembrane domains arranged in three tandemly repeated segments of approximately 100 amino acids each, forming a channel across the inner mitochondrial membrane. The protein likely contains the six transmembrane α-helices typical of the mitochondrial carrier family, with substrate binding sites located within the transmembrane regions .

What approaches can be used to produce recombinant slc25a36a protein for in vitro studies?

For recombinant production of zebrafish slc25a36a, researchers can utilize either prokaryotic (E. coli) or eukaryotic (mammalian cells) expression systems as evidenced by commercially available options . The methodological approach includes:

  • Prokaryotic expression system:

    • Clone the full-length slc25a36a coding sequence into a bacterial expression vector with appropriate tags (His-tag is commonly used)

    • Transform into an E. coli strain optimized for recombinant protein expression

    • Induce protein expression with IPTG

    • Purify using affinity chromatography (His-tag purification with Ni-NTA columns)

    • Validate protein identity and purity with SDS-PAGE and Western blotting

  • Mammalian cell expression system:

    • Clone the slc25a36a coding sequence into a mammalian expression vector

    • Transfect mammalian cells (e.g., HEK293, CHO cells)

    • Select stable cell lines

    • Harvest and purify protein using affinity chromatography

    • Confirm with functional assays

The choice between expression systems should be guided by downstream applications, as prokaryotic systems may lack post-translational modifications present in the native zebrafish protein .

How can CRISPR/Cas9 technology be employed to generate slc25a36a knockout zebrafish models?

Based on established CRISPR/Cas9 methodologies for similar genes, the following protocol can be implemented:

  • gRNA design and validation:

    • Design target-specific 20 nt guide RNAs targeting early constitutive exons of slc25a36a

    • Evaluate potential off-target effects using bioinformatics tools

    • Create a pool of 2-3 different gRNAs to maximize knockout efficiency

  • Microinjection:

    • Prepare Cas9 protein or mRNA together with validated gRNAs

    • Microinject into one-cell stage zebrafish embryos

    • Include fluorescent markers to track successful injection

  • Founder screening:

    • Extract genomic DNA from fin clips of potential founders

    • Perform PCR amplification of the target region

    • Analyze indels using T7E1 assay, heteroduplex mobility assay, or direct sequencing

    • Select founders with frameshift mutations leading to functional knockouts

  • Establishing stable lines:

    • Outcross founders with wild-type fish

    • Genotype F1 offspring

    • Intercross heterozygous F1 to obtain homozygous knockouts in F2

  • Phenotypic characterization:

    • Analyze developmental, cellular, and molecular phenotypes

    • Compare with wild-type controls using appropriate assays

This approach enables the creation of stable genetic models for investigating slc25a36a function in vivo .

What methodologies are available for studying slc25a36a transport function in vitro?

The transport function of slc25a36a can be studied using reconstitution in phospholipid vesicles, similar to methods used for human SLC25A36 :

  • Protein reconstitution:

    • Express and purify recombinant slc25a36a protein

    • Prepare liposomes from phospholipids (typically phosphatidylcholine)

    • Reconstitute purified protein into liposomes through freeze-thaw cycles

    • Remove external substrate by gel filtration

  • Transport assays:

    • Load liposomes with specific substrates (radiolabeled nucleotides)

    • Initiate transport by adding external substrate or creating a concentration gradient

    • Measure substrate uptake/exchange at different time points

    • Determine kinetic parameters (Km, Vmax) for different substrates

  • Inhibition studies:

    • Test effects of known mitochondrial carrier inhibitors (mercurial compounds)

    • Investigate substrate specificity by competition assays

    • Evaluate pH and temperature dependence of transport activity

This approach allows for detailed biochemical characterization of transport properties, substrate specificity, and kinetic parameters .

How can transgenic zebrafish expressing fluorescently-tagged slc25a36a be generated to study subcellular localization?

Developing transgenic zebrafish with fluorescently-tagged slc25a36a involves:

  • Construct design:

    • Create a fusion construct encoding slc25a36a with a fluorescent protein (GFP, mCherry)

    • Place under control of a ubiquitous promoter (e.g., ubiquitin) or tissue-specific promoter

    • Include Tol2 transposon elements for efficient genomic integration

  • Microinjection:

    • Co-inject the construct with Tol2 transposase mRNA into one-cell embryos

    • Screen for fluorescence expression at 24-48 hpf

  • Establishing stable lines:

    • Raise injected embryos to adulthood (F0 founders)

    • Cross with wild-type fish and screen F1 offspring for germline transmission

    • Establish homozygous lines through subsequent crosses

  • Imaging and analysis:

    • Perform confocal microscopy on live embryos or fixed tissues

    • Co-stain with mitochondrial markers to confirm expected subcellular localization

    • Analyze dynamic behavior using time-lapse imaging

This approach enables visualization of protein localization and dynamics in vivo, particularly valuable for confirming mitochondrial targeting as expected for a mitochondrial carrier family member .

What approaches can be used to investigate potential roles of slc25a36a in zebrafish development and physiology?

To investigate developmental and physiological roles:

  • Loss-of-function studies:

    • Generate CRISPR/Cas9 knockout lines as described above

    • Use morpholino oligonucleotides for transient knockdown

    • Analyze developmental phenotypes systematically:

      • Morphological development

      • Tissue-specific effects

      • Behavioral changes

  • Rescue experiments:

    • Perform RNA rescue in knockout/knockdown models

    • Create transgenic rescue lines expressing wild-type or mutant slc25a36a

    • Test human SLC25A36 for cross-species functional conservation

  • Metabolic profiling:

    • Measure nucleotide levels in subcellular fractions

    • Analyze mitochondrial DNA and RNA synthesis rates

    • Evaluate mitochondrial function (oxygen consumption, membrane potential)

  • Tissue-specific phenotyping:

    • Perform histological analysis of relevant tissues

    • Evaluate cell-type specific effects using lineage markers

    • Assess mitochondrial morphology and distribution using electron microscopy

This multi-faceted approach can reveal both specific cellular functions and broader physiological roles of slc25a36a .

How can high-throughput screening approaches be utilized to identify compounds affecting slc25a36a function?

For high-throughput screening:

  • Development of cellular assays:

    • Create stable cell lines expressing slc25a36a with reporter systems

    • Develop transport assays amenable to high-throughput format

    • Optimize assay conditions for sensitivity and reproducibility

  • Screening methodology:

    • Utilize automated liquid handling for compound delivery

    • Implement fluorescence-based or luminescence-based readouts

    • Screen compound libraries (FDA-approved drugs, natural products)

  • Validation workflow:

    • Confirm hits with dose-response curves

    • Evaluate specificity using related carrier proteins as controls

    • Perform counter-screens to eliminate false positives

  • In vivo validation:

    • Test validated compounds in zebrafish models

    • Assess ability to rescue knockout phenotypes

    • Evaluate toxicity and pharmacokinetic parameters

This approach could identify novel modulators of nucleotide transport with potential research and therapeutic applications .

How does zebrafish slc25a36a compare functionally to its human ortholog SLC25A36?

Based on comparative studies of related mitochondrial carriers:

ParameterZebrafish slc25a36aHuman SLC25A36Notes
Substrate specificityPredicted to transport pyrimidine nucleotidesTransports cytosine and uracil nucleosides (mono-, di-, triphosphates)Human SLC25A36 has been biochemically characterized
Transport mechanismLikely uniport and antiportUniport and antiport confirmedSimilar mechanisms likely preserved
Mitochondrial targetingPredictedConfirmedBoth contain characteristic mitochondrial targeting sequences
Tissue expressionNot fully characterizedWidely expressedExpression patterns may differ between species
Genetic conservation-~70-80% amino acid identity (estimated)Conservation in functional domains highest

What research strategies can be employed to investigate potential roles of slc25a36a in disease models?

For disease-related research:

  • Human disease correlation:

    • Identify human conditions linked to SLC25A36 dysfunction

    • Analyze patient-derived mutations in zebrafish models

    • Create equivalent mutations in zebrafish slc25a36a using CRISPR/Cas9

  • Phenotypic analysis in disease contexts:

    • Evaluate mitochondrial function in knockout models

    • Assess cellular stress responses

    • Measure nucleotide imbalances and consequences

    • Investigate potential links to:

      • Neurodevelopmental disorders

      • Metabolic dysfunction

      • Mitochondrial diseases

  • Chemical and genetic modifier screens:

    • Perform suppressor/enhancer screens in sensitized backgrounds

    • Identify genetic interactions with known disease genes

    • Test compounds that rescue disease-related phenotypes

  • Therapeutic testing platform:

    • Use zebrafish disease models for drug screening

    • Evaluate gene therapy approaches

    • Test small molecule carriers as potential therapeutics

These approaches leverage the advantages of zebrafish models while maintaining translational relevance to human disease .

What are the key considerations for antibody validation when studying slc25a36a in zebrafish?

For antibody validation:

  • Multiple validation approaches:

    • Western blotting against recombinant protein and zebrafish samples

    • Immunoprecipitation followed by mass spectrometry

    • Immunostaining of wild-type and knockout tissues

    • Pre-absorption controls with purified antigen

  • Specificity considerations:

    • Cross-reactivity with related family members (especially slc25a36b paralog)

    • Non-specific binding evaluation

    • Background in knockout/knockdown samples

  • Documentation requirements:

    • Validation data including full blot images

    • Experimental conditions (fixation, blocking, dilutions)

    • Lot-to-lot variation assessment

    • Positive and negative control results

Custom antibodies can be developed using recombinant slc25a36a protein as immunogen, as indicated by commercially available options .

How can researchers address common challenges in recombinant slc25a36a protein expression and purification?

Common challenges and solutions include:

  • Protein solubility issues:

    • Optimize expression conditions (temperature, induction time)

    • Use solubility-enhancing fusion tags (SUMO, MBP)

    • Employ mild detergents for membrane protein extraction

    • Consider refolding from inclusion bodies if necessary

  • Purification challenges:

    • Implement two-step purification protocols (affinity + size exclusion)

    • Optimize buffer conditions (pH, salt concentration)

    • Include stabilizing agents (glycerol, specific lipids)

    • Control temperature throughout purification process

  • Functional preservation:

    • Maintain native-like lipid environment when possible

    • Avoid harsh elution conditions

    • Confirm activity with transport assays post-purification

    • Consider nanodiscs or amphipols for stabilization

  • Quality control criteria:

    • Purity assessment by SDS-PAGE (>90% recommended)

    • Identity confirmation by mass spectrometry

    • Functional validation through binding or transport assays

    • Stability monitoring by dynamic light scattering

These considerations are particularly important for membrane proteins like slc25a36a, which often present challenges in heterologous expression systems .

What emerging technologies might enhance our understanding of slc25a36a function in zebrafish?

Cutting-edge approaches for future research include:

  • Single-cell technologies:

    • Single-cell RNA-seq to map cell-type specific expression patterns

    • Single-cell metabolomics to assess cellular heterogeneity in response to slc25a36a dysfunction

    • Spatial transcriptomics to correlate expression with tissue microenvironments

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed mitochondrial localization

    • FRET sensors to monitor nucleotide transport in real-time

    • Intravital imaging in transparent zebrafish embryos

  • CRISPR-based technologies:

    • CRISPRi/CRISPRa for reversible gene modulation

    • Base editing for precise mutation introduction

    • Prime editing for sophisticated genomic modifications

    • Optogenetic control of expression

  • Integrative multi-omics:

    • Combined proteomics, metabolomics, and transcriptomics

    • Network analysis to identify regulatory pathways

    • Computational modeling of nucleotide transport dynamics

These emerging technologies offer unprecedented resolution and control for investigating slc25a36a biology in zebrafish model systems .

How might interdisciplinary approaches advance slc25a36a research beyond current limitations?

Interdisciplinary strategies include:

  • Computational biology integration:

    • Molecular dynamics simulations of transport mechanisms

    • Machine learning for pattern recognition in phenotypic data

    • Pathway modeling to predict systemic effects of slc25a36a dysregulation

  • Evolutionary and comparative biology:

    • Comparative genomics across vertebrate lineages

    • Functional evolution of nucleotide transport mechanisms

    • Adaptation of mitochondrial carriers in different environmental contexts

  • Systems biology approaches:

    • Flux analysis of nucleotide metabolism

    • Network perturbation analysis

    • Whole-organism physiological modeling

  • Translational applications:

    • Drug development targeting nucleotide transport

    • Biomarker identification for related human conditions

    • Gene therapy strategies applicable to human disorders

These interdisciplinary approaches can overcome current research limitations and provide comprehensive understanding of slc25a36a biology with potential therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.