Recombinant Danio rerio Solute carrier family 25 member 46 (slc25a46)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Dynamics

slc25a46 regulates mitochondrial architecture by interacting with:

  • Fusion proteins: MFN2 and OPA1 .

  • MICOS complex: Critical for cristae organization .

  • ER membrane complex (EMC): Facilitates phospholipid transfer .

Key Phenotypes in Knockout Models:

ModelPhenotypeCitation
Zebrafish F0 CrispantsCurly-tail morphology, impaired motility
Zebrafish F4 KnockoutsGenetic compensation via anxa6 upregulation
Human FibroblastsHyperfused mitochondria, cristae defects

Applications in Disease Research

Neurodegenerative Disorders:

  • Mutations in SLC25A46 homologs are linked to:

    • Leigh syndrome: Mitochondrial respiration deficits (50% reduced basal OCR) .

    • Pontocerebellar hypoplasia (PCH): Neuronal loss and cerebellar atrophy .

    • Charcot-Marie-Tooth disease type 2 (CMT2): Axonal degeneration .

Therapeutic Insights:

  • Overexpression induces mitochondrial fragmentation, while loss-of-function causes elongation, implicating slc25a46 in fission/fusion balance .

  • Altered phospholipid profiles (e.g., reduced phosphatidylserine, elevated plasmalogens) suggest disrupted lipid homeostasis .

Research Tools and Assays

ELISA Kits:

  • Available for quantitative detection (e.g., CSB-CF724926DIL) .

  • Sensitivity: Optimized for zebrafish-derived samples.

CRISPR/Cas9 Models:

  • F0 Crispants: Show penetrant phenotypes (e.g., motor neuron defects) .

  • Stable Knockouts: Exhibit compensatory gene expression (e.g., anxa6) .

Key Findings from Zebrafish Studies

  • Genetic Compensation: F4 mutants lack severe phenotypes seen in F0 due to anxa6-mediated adaptation .

  • Mitochondrial Morphology:

    • Elongated mitochondria in morphants .

    • Rescue by wild-type mRNA injection .

Future Directions

  • Mechanistic Studies: Clarify slc25a46’s role in lipid transfer vs. fission/fusion.

  • Therapeutic Screens: Use recombinant protein to identify modifiers of mitochondrial dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Synonyms
slc25a46; si:ch211-220b11.2; zgc:92767; Solute carrier family 25 member 46
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-405
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a46
Target Protein Sequence
MTSRRPDSFEGLGYRGREDPAFSGGYSGRSFNNSSSSDLQNWVTTPPDIPGSRNLHFDDR TPQFETAPDEAQSAAPPSEQLNRFAGFGIGLASLFTENVLAHPCIVFRRQCQVNYHARCY HLSPMTAISVMYNVTKTQGPKALWKGMGSTFVVQGVTLGTEGIISECTPLPRELSHKWNP KQVVGHLVLKGLTYVVAMPFYSASLIETVQSEIIRDNPGILDCVKEGLGRVMGMGIPHSK RLLPLWNLVLPTVLHGILHYIISSSIQRLVLYLLRRRNNGSPKHSSPGSGMDTVQSMLDA YFPELMASFAASLCADVLLFPLETVLHRLHIQGTRTIIDNTDLGFEVLPINTQYEGMRDC INAIRREEGTMGFYKGFGSIVVQYSLHATVLQITKMIYSTLLRNA
Uniprot No.

Target Background

Function
This protein may play a role in mitochondrial dynamics by controlling mitochondrial membrane fission.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is SLC25A46 and what is its fundamental role in cellular function?

SLC25A46 is a mitochondrial outer membrane protein that belongs to the mitochondrial carrier family SLC25. Unlike most SLC25 family members that are localized to the inner mitochondrial membrane, SLC25A46 is integrated into the outer mitochondrial membrane where it serves as a critical regulator of mitochondrial dynamics . In Danio rerio and other vertebrates, SLC25A46 functions as the orthologue of yeast Ugo1, acting as a molecular bridge between mitochondrial fusion and fission machinery .

The protein plays an essential role in maintaining proper mitochondrial morphology by regulating the balance between fusion and fission events. It interacts with key mitochondrial dynamics proteins including MFN2 (mitofusin 2) and OPA1 (optic atrophy 1), as well as components of the mitochondrial contact site and cristae organizing system (MICOS) complex . Through these interactions, SLC25A46 helps maintain proper cristae architecture and facilitates lipid transfer between mitochondria and the endoplasmic reticulum (ER) .

How do mutations affect SLC25A46 function in model systems?

Mutations in SLC25A46 can dramatically alter mitochondrial morphology and function. Experimental evidence shows distinct phenotypic consequences depending on whether the mutation causes loss of function or expression of a destabilized protein:

Mutation TypeMitochondrial MorphologyCristae ArchitectureCellular ConsequencesReference
Complete knockoutFragmented mitochondriaAbnormal cristae ultrastructureImpaired cellular respiration
Pathogenic variants (e.g., p.T142I, p.R257Q, p.E335D)Hyperfused mitochondriaAbnormal cristae that are not rescued by variant expressionAltered OPA1 and MFN2 oligomerization
Destabilizing mutationsMitochondrial hyperfusionMarkedly shortened cristaeImpaired respiration, premature cellular senescence

These findings demonstrate that SLC25A46 function is critical for maintaining proper mitochondrial architecture and dynamics, with mutations causing opposing effects on mitochondrial morphology (fragmentation vs. hyperfusion) depending on the specific alteration .

What are optimal methods for studying recombinant Danio rerio SLC25A46 in vitro?

For in vitro studies of recombinant Danio rerio SLC25A46, researchers should consider the following methodological approach:

  • Protein expression and purification: Recombinant SLC25A46 can be expressed using bacterial or eukaryotic expression systems. For optimal folding of this membrane protein, mammalian or insect cell expression systems are preferable. The protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage .

  • Functional assays: To assess SLC25A46 function:

    • Reconstitution into liposomes to study membrane interactions

    • Lipid transfer assays to examine its role in phospholipid trafficking

    • Protein-protein interaction studies using co-immunoprecipitation or crosslinking approaches

  • Structural studies: Recent advances employ crosslinking mass spectrometry to identify interaction interfaces of SLC25A46 with binding partners such as OPA1 and MFN2 . This can be complemented with computational approaches using AlphaFold 2 modeling .

When working with recombinant proteins, researchers should avoid repeated freeze-thaw cycles, as this can compromise protein integrity. Working aliquots should be stored at 4°C for up to one week .

How can researchers effectively study SLC25A46 protein-protein interactions?

Studying SLC25A46 protein-protein interactions requires specialized techniques due to its nature as a membrane protein. Based on recent research, the following methodological approaches are recommended:

  • Crosslinking mass spectrometry (XL-MS): This powerful technique has been successfully employed to identify interaction interfaces between SLC25A46 and its binding partners:

    • Use crosslinkers like BS3 (bis(sulfosuccinimidyl)suberate) at 0.75 mM concentration for protein complexes

    • For improved coverage, BS(PEG) crosslinkers can be used when studying interactions with proteins like Opa1 and Mfn2

    • Samples should be separated on polyacrylamide gels (e.g., 7.5%) and bands excised for mass spectrometry analysis

  • Co-immunoprecipitation: SLC25A46 co-immunoprecipitates with mitochondrial fusion machinery components, enabling researchers to study these protein complexes:

    • SLC25A46 interactions with OPA1 and MFN2 can be assessed this way

    • Loss of function mutations alter the oligomerization state of these partners

  • Proximity labeling approaches: These techniques can identify the broader interactome of SLC25A46:

    • Studies have revealed SLC25A46 interactions with components of the ER membrane, lipid transfer proteins, and other mitochondrial outer membrane proteins

    • This approach has demonstrated SLC25A46's presence at interorganellar contact sites

These methods should be combined with functional validation through genetic manipulation (knockouts, variant expression) to confirm the biological significance of identified interactions .

What is the specific role of SLC25A46 in mitochondrial fusion and fission?

SLC25A46 plays a critical role in regulating the balance between mitochondrial fusion and fission events. Recent studies have revealed several key aspects of its function:

  • Localization at dynamic mitochondrial sites: SLC25A46 is present in discrete puncta at mitochondrial branch points and tips of mitochondrial tubules, where it co-localizes with both DRP1 (a fission protein) and OPA1 (a fusion protein) . This strategic positioning allows it to influence both fusion and fission events.

  • Fusion/fission regulation: Virtually all mitochondrial fission and fusion events are demarcated by an SLC25A46 focus, indicating its central role in these processes . Its function appears similar to yeast Ugo1, acting as a molecular bridge between the fusion and fission machinery.

  • Interaction with key dynamics proteins: SLC25A46 directly interacts with:

    • MFN2 on the outer mitochondrial membrane

    • OPA1 on the inner mitochondrial membrane

    • Components of the MICOS complex

  • Effect on partner proteins: Loss of SLC25A46 function alters the oligomerization state of both OPA1 and MFN2, demonstrating its regulatory role in the assembly and function of these key fusion proteins .

The importance of SLC25A46 in mitochondrial dynamics is evidenced by the dramatic morphological changes observed when it is disrupted: knockout cells display fragmented mitochondria, while certain pathogenic variants lead to hyperfused mitochondria .

How does SLC25A46 contribute to mitochondrial lipid homeostasis?

SLC25A46 serves as a critical facilitator of lipid homeostasis between mitochondria and the endoplasmic reticulum. Its role extends beyond simple mitochondrial dynamics to the regulation of membrane composition:

  • Interorganellar contact sites: Proximity interaction mapping has identified SLC25A46 at contact sites between mitochondria and the ER, where it interacts with:

    • Components of the ER membrane

    • Lipid transfer proteins

    • Other mitochondrial outer membrane proteins

  • Lipid composition regulation: Loss of SLC25A46 function leads to altered mitochondrial lipid composition, suggesting its role in:

    • Facilitating interorganellar lipid flux

    • Participating in membrane remodeling associated with fusion and fission events

  • ER-mitochondria pathway: SLC25A46 interacts with the ER membrane protein complex (EMC), further supporting its role in a mitochondrial/ER pathway that facilitates lipid transfer .

This lipid transfer function is particularly important as proper membrane composition is essential for both mitochondrial fusion events and for maintaining the characteristic architecture of mitochondrial cristae.

What are the implications of SLC25A46 dysfunction in disease models?

SLC25A46 dysfunction has been linked to a spectrum of neurodegenerative disorders, with research revealing several critical disease mechanisms:

Disease AssociationCellular PhenotypeMolecular MechanismReference
Leigh syndromeMitochondrial hyperfusion, cristae abnormalitiesDestabilized SLC25A46 protein
Optic atrophy spectrum disordersAbnormal mitochondrial morphologyVarious SLC25A46 mutations
Pontocerebellar hypoplasiaSevere neurodegenerationBiallelic loss-of-function mutations
Broad neurodegenerative phenotypesImpaired cellular respirationDisruption of MICOS complex

The pathogenesis involves several interrelated mechanisms:

  • Cristae architecture disruption: Loss of SLC25A46 function disrupts the MICOS complex, resulting in abnormal mitochondrial ultrastructure with markedly shortened cristae . This structural abnormality impairs the organization of respiratory chain complexes.

  • Bioenergetic consequences: Fibroblasts from affected individuals show impaired basal oxygen consumption, although maximal uncoupled electron flow remains unaffected . This selective impairment suggests a regulatory rather than structural role in oxidative phosphorylation.

  • Premature cellular senescence: SLC25A46 dysfunction leads to premature cellular senescence, linking mitochondrial dynamics to cell fate decisions and potentially explaining the progressive nature of associated neurodegenerative diseases .

These findings establish SLC25A46 as a critical factor in mitochondrial health, with its dysfunction contributing to neurodegeneration through multiple interconnected pathways affecting both mitochondrial structure and function .

How can novel SLC25A46 variants be identified and characterized in experimental models?

Identification and characterization of novel SLC25A46 variants requires a multifaceted approach combining genomic, biochemical, and cellular techniques:

  • Exome sequencing and reanalysis: Reanalysis of existing exome data using updated variant calling algorithms has successfully identified novel SLC25A46 variants associated with conditions like Leigh syndrome . This approach is particularly valuable as our understanding of variant pathogenicity evolves.

  • Functional validation workflow:

    • Generate knockout cell lines using CRISPR/Cas9 (as demonstrated for human fibroblasts)

    • Reintroduce wild-type or variant SLC25A46 to assess rescue capability

    • Evaluate mitochondrial morphology using fluorescence microscopy

    • Assess mitochondrial ultrastructure using electron microscopy

    • Measure respiratory function through oxygen consumption assays

  • Protein stability assessment: Pathogenic mutations often destabilize the SLC25A46 protein. Western blotting with careful quantification can determine if variants affect protein levels or stability .

  • Interaction profiling: Novel variants should be assessed for their impact on SLC25A46's interactions with partner proteins:

    • Co-immunoprecipitation with MFN2, OPA1, and MICOS components

    • Crosslinking mass spectrometry to identify altered interaction interfaces

    • Analysis of partner protein oligomerization states (particularly OPA1 and MFN2)

This comprehensive approach allows researchers to establish not only the presence of variants but also their functional significance and potential disease mechanisms.

What advanced techniques can reveal SLC25A46's role in interorganellar communication?

Understanding SLC25A46's role in interorganellar communication requires sophisticated techniques that can capture dynamic protein interactions and membrane contacts:

  • Proximity-based interactome mapping: This approach identifies proteins in close proximity to SLC25A46 at mitochondria-ER contact sites:

    • BioID or APEX2 proximity labeling can be employed

    • Mass spectrometry analysis reveals the broader protein network

    • Results have identified components of the ER membrane, lipid transfer proteins, and mitochondrial outer membrane proteins as SLC25A46 interaction partners

  • Lipid composition analysis: Lipidomic approaches can quantify changes in mitochondrial membrane composition resulting from SLC25A46 dysfunction:

    • High-performance liquid chromatography-mass spectrometry (HPLC-MS)

    • Analysis of specific phospholipid species and cardiolipin content

    • Comparison between wild-type and SLC25A46-deficient mitochondria

  • Live-cell imaging of interorganellar contacts: Super-resolution microscopy techniques can visualize:

    • SLC25A46 localization at mitochondria-ER contact sites

    • Dynamic changes in these contacts following manipulation of SLC25A46

    • Co-localization with other contact site proteins

  • Lipid transfer assays: Functional assays can directly measure lipid movement between organelles:

    • Fluorescently labeled lipids can track interorganellar transfer

    • In vitro reconstitution systems with purified components

    • Comparison of transfer rates in the presence of wild-type vs. mutant SLC25A46

These advanced approaches have revealed that SLC25A46 is not merely a structural protein but plays an active role in facilitating lipid transfer and membrane remodeling at the interface between mitochondria and the ER .

How do findings from zebrafish SLC25A46 studies translate to human disease mechanisms?

Zebrafish (Danio rerio) serve as valuable models for studying SLC25A46-related diseases due to significant conservation of mitochondrial dynamics pathways across vertebrates. Key translational insights include:

  • Evolutionary conservation: The zebrafish SLC25A46 protein shares significant homology with human SLC25A46, maintaining key functional domains and interaction interfaces . This conservation extends to its role in mitochondrial dynamics and cristae maintenance.

  • Disease modeling potential: Zebrafish models can recapitulate key aspects of human SLC25A46-related pathologies:

    • Neurodegenerative features observed in patients with SLC25A46 mutations

    • Mitochondrial morphology abnormalities

    • Bioenergetic defects measurable in cellular and tissue contexts

  • Comparative insights: Studies in mice have shown that loss of SLC25A46 causes neurodegeneration by affecting mitochondrial dynamics and energy production . These findings parallel observations in human patients and can be further explored in zebrafish models.

  • Therapeutic screening applications: The zebrafish model offers advantages for testing potential therapeutic approaches:

    • High-throughput screening capability

    • Visualization of mitochondrial dynamics in vivo

    • Assessment of impacts on neural development and function

While direct zebrafish-to-human translation requires careful consideration of species differences, the fundamental conservation of SLC25A46 function across vertebrates makes findings in this model system highly relevant to understanding human disease mechanisms .

What methodological challenges exist in studying SLC25A46 across different model systems?

Researchers face several methodological challenges when studying SLC25A46 across different model systems, requiring careful experimental design and interpretation:

  • Expression system considerations: The recombinant expression of membrane proteins like SLC25A46 presents challenges:

    • Proper folding and post-translational modifications may differ between expression systems

    • Zebrafish proteins may require specific conditions for optimal expression in heterologous systems

    • Storage and handling require careful optimization to maintain functional integrity

  • Functional assay standardization: When comparing SLC25A46 function across species:

    • Different experimental conditions may be required for optimal activity

    • Interaction partners may vary between species

    • Quantitative comparisons must account for system-specific factors

  • Model-specific phenotypic differences: SLC25A46 dysfunction manifests differently across models:

    • Complete knockout in cells leads to mitochondrial fragmentation

    • Certain pathogenic variants cause mitochondrial hyperfusion

    • Organismal phenotypes may include varying degrees of neurodegeneration

    • Species-specific compensatory mechanisms may influence phenotypic outcomes

  • Technical limitations in interaction studies: Crosslinking mass spectrometry has revealed important insights but faces challenges:

    • Limited sequencing depth for SLC25A46 in some samples

    • Need for excess purified proteins to overcome detection limitations

    • Careful selection of appropriate crosslinkers (e.g., BS3 vs. BS(PEG)5) for optimal results

Addressing these challenges requires careful experimental design with appropriate controls and complementary methodologies to ensure robust and translatable findings across different model systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.