Recombinant Danio rerio Solute carrier family 25 member 48 (slc25a48)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Danio rerio Solute Carrier Family 25 Member 48 (slc25a48)

Recombinant Danio rerio (zebrafish) Solute Carrier Family 25 Member 48 (slc25a48) is a mitochondrial inner membrane transporter protein expressed in E. coli with an N-terminal His tag. It belongs to the SLC25 family, which facilitates metabolite exchange across mitochondrial membranes, critical for nucleotide synthesis, energy metabolism, and cell survival . This recombinant protein is used extensively in biochemical assays, functional studies, and disease modeling due to its role in mitochondrial choline transport and purine metabolism regulation .

Role in Mitochondrial Metabolism

SLC25A48 mediates mitochondrial choline import, enabling choline catabolism into betaine and purine nucleotides . Key functional findings include:

  • Choline Transport: Loss of SLC25A48 reduces mitochondrial choline uptake by 60–70%, impairing betaine synthesis .

  • Purine Nucleotide Regulation:

    MetaboliteSLC25A48-KO vs. Rescued Cells (Mitochondria)
    Betaine aldehydeUndetectable in KO
    Betaine↓ 80%
    FAD↓ 45%
    NAD/NADPH↓ 50%
    AMP/GDP↓ 30–40%
  • Cell Cycle Impact: SLC25A48-deficient cancer cells (e.g., ovarian, lung) show G1/S phase arrest and >50% cell death within 24 hours .

Thermogenesis and Respiration

In brown adipose tissue, SLC25A48 knockout reduces mitochondrial respiration by 40% and impairs cold tolerance in vivo .

Research Applications

  • Metabolic Studies: Used to investigate mitochondrial choline-betaine flux and one-carbon metabolism .

  • Cancer Research: Models purine nucleotide dependency in cancer cell proliferation (e.g., SKOV3, A549) .

  • Antibody Production: Rabbit anti-zebrafish slc25a48 polyclonal antibodies enable ELISA and Western blot validation .

  • Structural Analysis: Six transmembrane α-helix architecture studied for ligand-binding residues and transport mechanisms .

Recent Research Findings

  1. Choline-Dependent Betaine Synthesis: SLC25A48-KO mitochondria show undetectable betaine aldehyde and 80% lower betaine levels, linking choline transport to methyl donor availability .

  2. Purine Nucleotide Depletion: Reduced mitochondrial GDP, AMP, and FAD levels disrupt TCA cycle activity and respiratory complex I/II function .

  3. Therapeutic Implications: SLC25A48 loss reduces tumor growth in pancreatic (PA-TU-8988T) and lung (H1299) cancers, highlighting its role in de novo nucleotide synthesis .

  4. Genetic Association: GWAS links SLC25A48 variants to plasma choline levels, suggesting clinical relevance in metabolic disorders .

References (Integrated Citations)

  • Production and storage:

  • Functional studies:

  • Disease relevance:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
It is advisable to briefly centrifuge the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
slc25a48; zgc:92090; Solute carrier family 25 member 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a48
Target Protein Sequence
MTVFQLDDFLAGWIGGASSVIVGHPLDTVKTRLQAGKGYKNTFHCVVTIYKKENVIGFFK GLSFPLASITLYNSMVFGFFSNTQRLISKYRYGDGRHPCSMLDLTVASMLTGLVSVGVGA PVDLVKIRLQMQTQPVLAENFNLAGNGSVPLRSMGIQSQSFYRGPLHCISTVLQNEGIQG LYRGAGAMILRDIPGYALYFIPYTLFCNWLNPDDNSSPPPCCIWLAGGLAGSISWVTATP SDVVKSRLQADAMHQRKYKGILHCIMQSYRTEGIHVFFRGATVNAIRGFPMCATMFLGYE LSLQFFRSF
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is slc25a48 and what is its predicted function in zebrafish?

Slc25a48 (solute carrier family 25 member 48) is a protein-coding gene located on chromosome 14 in Danio rerio (zebrafish). It is predicted to enable transmembrane transporter activity, specifically acting within transmembrane transport pathways. The protein is predicted to be located in the mitochondrial inner membrane and to be active in mitochondria. It is orthologous to human SLC25A48, which encodes a member of the mitochondrial carrier protein family .

Recent research suggests that SLC25A48 may function as a mitochondrial choline transporter, as evidenced by its impact on betaine and phosphocholine levels when the gene is knocked out . Immunofluorescence experiments have confirmed the mitochondrial localization of SLC25A48, which is consistent with its predicted cellular location .

How should recombinant slc25a48 protein be stored and handled for experimental use?

For optimal stability and activity, recombinant Danio rerio slc25a48 protein should be stored in a Tris-based buffer with 50% glycerol. Short-term storage can be at -20°C, while extended storage is recommended at -20°C or -80°C .

For working with the protein, it is advisable to avoid repeated freezing and thawing cycles, as this can lead to protein degradation and loss of activity. Instead, prepare working aliquots that can be stored at 4°C for up to one week . When designing experiments, consider that the recombinant protein may include a tag (the specific tag type is determined during the production process), which might affect certain experimental applications or require additional controls.

What types of transcripts have been identified for the slc25a48 gene?

According to genomic resources, the zebrafish slc25a48 gene produces multiple transcript variants:

TypeNameAnnotation MethodLength (nt)
aberrant processed transcriptslc25a48-202Ensembl841 nt
mRNAslc25a48-201Ensembl1,551 nt
ncRNAslc25a48-003Ensembl921 nt

This indicates that the gene undergoes alternative splicing, producing different transcript variants including protein-coding mRNA and non-coding RNA . This complexity should be considered when designing experiments targeting slc25a48 expression, as different transcripts may have distinct functions or regulations.

What evidence supports SLC25A48's role as a mitochondrial choline transporter?

Recent research has provided compelling evidence for SLC25A48's role as a mitochondrial choline transporter:

  • Mitochondrial metabolome profiling: Studies comparing SLC25A48-knockout cells with cDNA-complemented controls revealed significant reductions in betaine and phosphocholine levels in mitochondria lacking SLC25A48 .

  • Choline transport assays: Radioactive [Methyl-3H]Choline uptake assays on immunopurified mitochondria demonstrated that SLC25A48 mediates mitochondrial choline import, thereby impacting betaine production .

  • Pathway analysis: SLC25A48's involvement in betaine production aligns with the known two-step oxidation of choline by mitochondrially-localized enzymes (choline dehydrogenase and aldehyde hydrogenase 7 family member 1) .

To investigate this function further, researchers should consider implementing metabolomic profiling of immunopurified mitochondria using liquid chromatography-mass spectrometry and radioactive transport assays with labeled substrates. The engineering of knockout and cDNA-complemented cell lines expressing mitochondrial markers (such as 3xHA-OMP25 Mito-Tag) would facilitate such studies .

What approaches can be used to study slc25a48 function in zebrafish models?

Several methodological approaches can be employed to study slc25a48 function in zebrafish:

  • Gene knockout strategies: Transcription activator-like effector nucleases (TALEN) technology has been successfully used in zebrafish to generate knockout lines by creating small deletions in target exons resulting in premature stop codons and truncated proteins . Similar approaches could be applied to slc25a48.

  • In vivo imaging: Transgenic zebrafish expressing fluorescent reporters can be used to visualize processes affected by slc25a48. For example, studies have used zebrafish expressing cdh17::GFP (a pronephric tubule marker) along with fluorescent tracers to assess endocytic function .

  • Cellular localization studies: Immunofluorescence techniques can confirm the subcellular localization of slc25a48 in zebrafish tissues .

  • Functional assays: For transport studies, methods such as in vivo endocytic assays following injection of fluorescently labeled substrates can be performed . Additionally, electron microscopy can provide ultrastructural insights into cellular compartments affected by slc25a48 deletion .

When designing zebrafish experiments, researchers should consider examining multiple developmental stages since gene function may vary throughout development.

What human diseases are associated with SLC25A48 variants?

Comprehensive rare variant analysis of SLC25A48 predicted loss-of-function (pLoF) variants in 469,787 individuals from the UK Biobank has identified significant associations with several disease phenotypes . The study revealed a departure of the observed p-value distribution from the expected (theoretical null) distribution, indicating highly significant disease associations, particularly with:

  • Musculoskeletal diseases

  • Digestive disorders

This suggests that SLC25A48 dysfunction may have broad pathophysiological consequences. The identification of these associations was achieved through analysis of variants that completely disable the gene, which may enable new insights into pathophysiological processes .

To further investigate these associations, researchers might consider:

  • Genotype-phenotype correlation studies

  • Functional characterization of disease-associated variants

  • Development of animal models expressing specific human variants

  • Metabolomic profiling of patient samples to identify altered choline metabolism

How can metabolomic approaches be used to investigate slc25a48 function?

Metabolomic profiling represents a powerful approach for investigating slc25a48 function, particularly given its potential role in mitochondrial transport processes:

  • Mitochondrial isolation: Immunopurification of mitochondria using engineered cells expressing mitochondrial markers (such as 3xHA-OMP25 Mito-Tag) allows for specific analysis of the mitochondrial metabolome .

  • Liquid chromatography-mass spectrometry (LC-MS): This technique can be used to comprehensively profile mitochondrial metabolites, enabling comparison between wild-type and slc25a48-deficient samples .

  • Targeted metabolite analysis: Based on the hypothesis that slc25a48 functions as a choline transporter, specific analysis of choline-related metabolites (such as betaine and phosphocholine) can provide insights into the protein's function .

  • Radioactive transport assays: Employing labeled substrates like [Methyl-3H]Choline in uptake assays on isolated mitochondria can directly assess the transport function of slc25a48 .

In one study, researchers detected significant reductions in betaine and phosphocholine levels in SLC25A48-knockout cells compared to both cDNA-complemented controls and parental cell lines, suggesting that SLC25A48 is a determinant of de novo betaine synthesis from choline .

How does slc25a48 function compare to other members of the SLC25 family?

The SLC25 family comprises multiple mitochondrial solute carriers with diverse substrate specificities and functions. Comparative analysis of slc25a48 with other family members reveals both similarities and differences:

  • Shared structural features: All SLC25 family members contain characteristic mitochondrial carrier domains and are localized to the mitochondrial inner membrane .

  • Differential expression patterns: Analysis of SLC25 family members in cancer contexts has identified 37 differentially expressed members (DEMs), with 18 upregulated and 19 downregulated in colon cancers compared to paracancerous tissues .

  • Prognostic significance: Several SLC25 family members, including SLC25A5 and SLC25A24, have been identified as valuable prognostic predictors in colon cancer patients .

  • Metabolic pathways: Different SLC25 family members are involved in distinct metabolic pathways. For example, SLC25A5 is associated with glycolysis, while SLC25A24 is linked to adipogenesis .

  • Immune cell infiltration: The expression of various SLC25 family members correlates differently with immune cell infiltration in tumors. For instance, SLC25A5 expression negatively correlates with CD8+ T cell infiltration but positively correlates with neutrophil infiltration .

Research comparing slc25a48 with other family members should employ functional assays that can distinguish between different transport substrates and metabolic pathways.

What experimental approaches can be used to validate the transport function of slc25a48?

Validating the transport function of slc25a48 requires multiple experimental approaches:

  • Radioactive substrate uptake assays: Using immunopurified mitochondria from cells with and without slc25a48 expression, researchers can measure the uptake of radiolabeled substrates such as [Methyl-3H]Choline. This approach directly assesses transport capacity and can be used to determine kinetic parameters .

  • Reconstitution in liposomes: Purified recombinant slc25a48 can be reconstituted into liposomes to study transport activity in a controlled environment, allowing for precise manipulation of substrate concentrations and membrane composition.

  • Metabolomic profiling: Comparing metabolite levels in mitochondria with and without slc25a48 expression can provide indirect evidence of transport function. For instance, decreased levels of betaine and phosphocholine in SLC25A48-knockout mitochondria suggest impaired choline transport .

  • Molecular dynamics simulations: Computational approaches can predict substrate binding sites and transport mechanisms based on the protein's structure.

  • Site-directed mutagenesis: Introducing specific mutations in conserved residues can help identify amino acids critical for substrate recognition and transport function.

For optimal results, these approaches should be combined to provide convergent evidence for slc25a48's transport function and substrate specificity.

How can recombinant slc25a48 be used in pharmaceutical research?

The emerging understanding of slc25a48 as a mitochondrial choline transporter opens several avenues for pharmaceutical research:

  • Target validation: Using recombinant slc25a48 in high-throughput screening assays could identify compounds that modulate its transport activity, potentially leading to therapeutics for diseases associated with choline metabolism.

  • Structure-based drug design: Detailed structural analysis of recombinant slc25a48 could inform the design of specific inhibitors or activators with potential therapeutic applications.

  • Biomarker development: The association of SLC25A48 variants with specific disease phenotypes suggests its potential as a biomarker for disease risk or progression .

  • Metabolic pathway modulation: Given its role in choline transport and betaine synthesis, compounds targeting slc25a48 might be used to modulate these metabolic pathways in disease states.

Research in this area should include careful validation of compound specificity and assessment of effects on related transporters within the SLC25 family.

What challenges exist in studying the physiological role of slc25a48 in zebrafish models?

Several challenges must be addressed when investigating slc25a48 in zebrafish models:

  • Functional redundancy: Like many genes, slc25a48 may have paralogs or functionally similar transporters that can compensate for its loss, potentially masking phenotypes in knockout models.

  • Developmental regulation: Studies in zebrafish have shown that careful regulation of gene expression during development is crucial. For example, precise regulation of cdc25a expression is essential for body extension and muscle cell fate determination . Similar complexities may apply to slc25a48.

  • Technical limitations: While techniques like TALEN have been successfully used to generate zebrafish knockout lines , achieving complete gene inactivation can be challenging, and phenotypic analysis requires specialized techniques.

  • Translating findings to human disease: Despite the orthology between zebrafish slc25a48 and human SLC25A48, differences in physiology and metabolism between species may affect the relevance of findings.

  • Cell-type specific functions: Expression of slc25a48 may vary across tissues and cell types, necessitating approaches that can detect and characterize these differences.

To address these challenges, researchers should consider employing conditional knockout approaches, tissue-specific expression analysis, and comparative studies with human cells and tissues.

How might the choline transport function of slc25a48 impact our understanding of mitochondrial metabolism?

The identification of slc25a48 as a potential mitochondrial choline transporter has significant implications for our understanding of mitochondrial metabolism:

  • Compartmentalization of choline metabolism: The transport of choline into mitochondria by slc25a48 supports the concept of metabolic compartmentalization within cells, with specific pathways occurring within distinct organelles.

  • Betaine synthesis pathway: Research has shown that betaine production involves the two-step oxidation of choline by mitochondrially-localized enzymes (choline dehydrogenase and aldehyde hydrogenase 7 family member 1) . Slc25a48's role in choline import directly impacts this pathway.

  • Mitochondrial methylation reactions: Choline-derived betaine serves as a methyl donor for various biochemical reactions. Slc25a48-mediated choline transport may therefore influence mitochondrial methylation processes.

  • Membrane phospholipid metabolism: Choline is a precursor for phosphatidylcholine synthesis, a major component of mitochondrial membranes. Slc25a48 may indirectly influence membrane composition and dynamics.

  • Disease mechanisms: The association of SLC25A48 variants with human diseases suggests that disruptions in mitochondrial choline transport may contribute to pathological processes .

Future research should investigate how slc25a48-mediated choline transport integrates with other metabolic pathways within mitochondria and how its dysfunction contributes to metabolic disorders.

What controls should be included when working with recombinant slc25a48 protein?

When conducting experiments with recombinant slc25a48 protein, several controls should be included to ensure reliable and interpretable results:

  • Tag-only controls: Since the recombinant protein may include a tag , experiments should include controls with the tag alone to distinguish tag-mediated effects from those of the protein.

  • Heat-inactivated protein: Using heat-denatured recombinant slc25a48 can help differentiate between specific protein activity and non-specific effects.

  • Related transporter controls: Including other members of the SLC25 family can help establish specificity of observed effects.

  • Substrate specificity controls: When assessing transport function, include structurally related compounds that are not expected to be transported to confirm substrate specificity.

  • Buffer controls: Since the recombinant protein is stored in a Tris-based buffer with 50% glycerol , appropriate buffer-only controls should be included to account for potential buffer effects.

  • Concentration gradients: Using different concentrations of recombinant protein can help establish dose-dependent effects and determine optimal working concentrations.

These controls will strengthen the validity of experimental findings and help address potential confounding factors.

How can researchers effectively design gene knockout studies for slc25a48 in zebrafish?

Designing effective gene knockout studies for slc25a48 in zebrafish requires careful consideration of several factors:

  • Targeting strategy: Technologies like transcription activator-like effector nucleases (TALEN) have been successfully used to generate zebrafish knockout lines by creating small deletions in target exons that result in premature stop codons and truncated proteins . For slc25a48, targeting conserved functional domains would be most effective.

  • Validation of knockout: Comprehensive validation should include:

    • Genomic DNA sequencing to confirm the intended mutation

    • RT-PCR to assess transcript levels and potential alternate splicing

    • Western blotting to confirm the absence of functional protein

    • Functional assays to verify loss of transport activity

  • Phenotypic analysis: Based on slc25a48's predicted function as a mitochondrial choline transporter , phenotypic analysis should include:

    • Metabolomic profiling of choline-related metabolites

    • Mitochondrial function assessments

    • Tissue-specific analyses focusing on organs with high choline utilization

  • Developmental timing: Since gene function may vary throughout development, analysis should encompass multiple developmental stages from early embryogenesis through adulthood.

  • Rescue experiments: To confirm specificity of observed phenotypes, rescue experiments should be performed by reintroducing wild-type or mutant slc25a48.

Using these approaches will provide robust evidence for the physiological function of slc25a48 in zebrafish models.

What techniques are most effective for studying the subcellular localization of slc25a48?

Several complementary techniques can be employed to study the subcellular localization of slc25a48:

  • Immunofluorescence microscopy: Using antibodies against slc25a48 together with established mitochondrial markers allows visualization of its localization. This approach has already confirmed the mitochondrial localization of SLC25A48 .

  • Subcellular fractionation: Isolating different cellular compartments (mitochondria, endoplasmic reticulum, plasma membrane) followed by Western blot analysis can provide biochemical evidence for slc25a48's localization.

  • Fluorescent protein fusion constructs: Creating slc25a48-GFP fusion proteins enables live-cell imaging of its localization and dynamics.

  • Electron microscopy with immunogold labeling: This provides high-resolution visualization of slc25a48's precise localization within mitochondrial subcompartments.

  • Proximity labeling techniques: Methods like BioID or APEX2 can identify proteins that physically interact with slc25a48, providing further evidence of its subcellular environment.

  • Mitochondrial isolation techniques: Using cells expressing mitochondrial markers (such as 3xHA-OMP25 Mito-Tag) enables immunopurification of mitochondria for further analysis .

When interpreting localization data, researchers should consider that overexpression systems may sometimes lead to mislocalization artifacts, making validation with endogenous protein crucial.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.