Recombinant Danio rerio Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial (sdhdb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
sdhdb; sdhd; sdhda; zgc:100986; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B, mitochondrial; CybS-B; Succinate dehydrogenase complex subunit D-B; Succinate-ubiquinone oxidoreductase cytochrome b small subunit B; Succinate-ubiquinone reductase membrane anchor subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-158
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
sdhdb
Target Protein Sequence
AVQQKDHDCSYLISARIHATPSNYAGSGSKAATMHWTGERILSIALLSLAPVAYFCPSPA VDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANAGLFVLSTVTFAGLCYFNYHDVGIC KAVALLWSK
Uniprot No.

Target Background

Function

Membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. It facilitates electron transfer from succinate to ubiquinone (coenzyme Q).

Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B (sdhdb) in zebrafish?

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit B (sdhdb) is a mitochondrial protein in Danio rerio (zebrafish) that functions as an integral membrane component of the succinate dehydrogenase complex. This protein is encoded by the sdhdb gene, which has several alternative names including sdhd, cybS-B, and zgc:100986 . The protein plays a crucial role in the mitochondrial electron transport chain and the citric acid cycle, serving as part of complex II in oxidative phosphorylation. In zebrafish, sdhdb is one of two paralogs (along with sdhda) that evolved through genome duplication, allowing for specialized functions in different tissues and developmental stages.

How does zebrafish sdhdb relate to human SDHB?

Zebrafish sdhdb is a functional ortholog of human SDHB, sharing significant sequence homology and conserved functional domains. Pathogenic variants in human SDHB are associated with phaeochromocytomas and paragangliomas (PPGLs), which are rare neuroendocrine tumors with limited treatment options when metastasized . The zebrafish sdhdb protein serves as an excellent model for studying SDHB function due to the conserved nature of mitochondrial metabolism across vertebrates. Heterozygous sdhb mutant zebrafish have been characterized as potential models for studying SDHB-related PPGLs, as they exhibit increased succinate levels similar to human patients, despite not developing obvious tumor phenotypes .

What are the common gene names and synonyms for zebrafish sdhdb?

The zebrafish sdhdb gene is known by several names in scientific literature and databases:

Primary Gene SymbolAlternative Gene SymbolsOther Names
sdhdbsdhdSuccinate dehydrogenase
sdhdaSuccinate dehydrogenase complex, subunit D
cybS-BIntegral membrane protein b
zgc:100986Succinate-ubiquinone oxidoreductase cytochrome b small subunit

This variety of nomenclature reflects both historical naming conventions and the identification of functional relationships with other proteins . When searching literature databases, researchers should include these alternative names to ensure comprehensive results.

What are the key differences between sdhda and sdhdb in zebrafish?

In zebrafish, both sdhda and sdhdb encode small subunits of the succinate dehydrogenase complex but differ in several aspects:

Featuresdhdasdhdb
Alternative namescybS-A, zgc:92857cybS-B, sdhd, zgc:100986
Expression patternTissue-specific expressionDifferent tissue distribution
Genomic locationDifferent chromosomeDifferent chromosome
FunctionSuccinate dehydrogenase subunitSuccinate dehydrogenase subunit with potential specialized functions

Both paralogs contribute to the succinate dehydrogenase complex function, but their differential expression suggests specialized roles in different tissues or developmental stages . This gene duplication in zebrafish provides a unique opportunity to study subfunctionalization of succinate dehydrogenase components.

What expression systems are optimal for producing recombinant zebrafish sdhdb protein?

Multiple expression systems have been successfully employed for the production of recombinant zebrafish sdhdb protein, each with distinct advantages:

Expression SystemAdvantagesConsiderations
Cell-Free ExpressionRapid production, avoids cell toxicity issues, suitable for membrane proteinsMay have lower yields, higher cost
E. coliHigh yield, cost-effective, well-established protocolsMay form inclusion bodies requiring refolding
YeastPost-translational modifications, proper folding of eukaryotic proteinsLonger production time than bacterial systems
BaculovirusExcellent for complex eukaryotic proteins, high yieldsMore complex setup, longer production time
Mammalian CellMost authentic post-translational modificationsHighest cost, lower yields, longer production time

How can researchers verify the purity and activity of recombinant sdhdb protein?

Verification of recombinant sdhdb protein quality should include multiple complementary approaches:

  • Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (≥85% purity is standard)

    • Western blot using specific antibodies against sdhdb

    • Size-exclusion chromatography to assess aggregation state

  • Activity Verification:

    • Succinate dehydrogenase enzyme activity assay measuring the reduction of artificial electron acceptors

    • Succinate-dependent oxygen consumption in reconstituted systems

    • Membrane integration assessment through liposome incorporation assays

  • Structural Integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Limited proteolysis to verify proper folding

    • Thermal shift assays to determine stability

For membrane proteins like sdhdb, verification of proper membrane incorporation is particularly important for functional studies, as improper folding can significantly impact activity measurements.

What phenotypes are observed in zebrafish sdhdb mutant models?

Zebrafish sdhdb mutants display distinct phenotypes depending on their genotype:

GenotypePhenotypic CharacteristicsLifespanBiochemical Features
Homozygous mutantsSevere developmental abnormalitiesSeverely decreased (up to 14 days)Increased succinate levels, impaired energy metabolism
Heterozygous mutantsGenerally normal appearance, some develop abnormalities (29 out of studied group)Similar to wild-type (93% survival at 2 years vs. 88% for wild-type)Significantly increased succinate levels despite absence of tumor phenotype
Wild-typeNormalStandard (control)Normal succinate levels

Interestingly, adult heterozygous sdhdb mutant zebrafish showed increased basal activity during day periods compared to wild-type siblings, though mitochondrial complex activity and catecholamine metabolite levels were not significantly different . These phenotypes make the heterozygous model particularly valuable for studying the early biochemical changes that precede tumor formation in SDHB-deficient conditions.

How should researchers standardize housing conditions for zebrafish sdhdb studies?

Housing conditions significantly impact zebrafish behavior and physiology, potentially affecting experimental outcomes in sdhdb studies:

Researchers should report these parameters in detail when publishing studies involving sdhdb zebrafish models to improve reproducibility . Controlling these variables is particularly important when studying subtle metabolic phenotypes that might be obscured by stress-induced changes.

What techniques are recommended for metabolic profiling in sdhdb mutant zebrafish?

For comprehensive metabolic assessment of sdhdb mutant zebrafish:

  • Succinate Level Measurement:

    • Liquid chromatography-mass spectrometry (LC-MS) for tissue extracts

    • Nuclear magnetic resonance (NMR) spectroscopy for non-targeted metabolomics

    • Enzymatic assays for targeted succinate quantification

  • Mitochondrial Function Assessment:

    • Oxygen consumption rate (OCR) measurements using microplate-based respirometry

    • Complex II activity assays using isolated mitochondria

    • Membrane potential assessment with fluorescent probes (TMRM, JC-1)

  • Energy Metabolism Analysis:

    • ATP/ADP ratio determination

    • Lactate production measurement to assess glycolytic shift

    • Glucose uptake and utilization assays

In sdhdb models, particular attention should be paid to TCA cycle intermediates and markers of mitochondrial dysfunction, as the primary defect affects the interface between the TCA cycle and electron transport chain . Tissue-specific analyses are recommended, as metabolic alterations may vary between different organs.

How can zebrafish sdhdb models advance understanding of human SDHB-related diseases?

Zebrafish sdhdb models offer several unique advantages for studying human SDHB-related pathologies:

  • Disease Progression Monitoring:
    Adult heterozygous sdhdb mutant zebrafish mimic human carriers by showing systemic elevation of succinate levels without tumor phenotype, allowing researchers to study pre-neoplastic metabolic changes .

  • Compound Screening:
    The zebrafish model enables high-throughput screening of compounds that might prevent progression from metabolic dysfunction to tumor formation in SDHB-deficient states.

  • Genetic Modifier Identification:
    The incomplete penetrance of tumor formation in both humans with SDHB mutations and zebrafish models suggests the presence of genetic modifiers that could be identified through genetic screens.

  • Developmental Effects Assessment:
    Since homozygous sdhdb mutation is lethal in zebrafish larvae within 14 days, the model allows for studying developmental consequences of complete SDHB deficiency, which is embryonically lethal in mammals .

  • Physiological Integration:
    Whole-organism studies in zebrafish enable assessment of systemic effects of sdhdb dysfunction on multiple organ systems simultaneously.

The zebrafish model is particularly valuable because human carriers of SDHB pathogenic variants have a lifelong tumor penetrance of around 50%, suggesting complex interactions between the genetic defect and other factors .

What signaling pathways should be investigated in sdhdb-deficient zebrafish?

Several key signaling pathways are affected by sdhdb deficiency and warrant investigation:

  • Hypoxia-Inducible Factor (HIF) Pathway:

    • Succinate accumulation inhibits prolyl hydroxylases, stabilizing HIF-1α

    • HIF target gene expression analysis (VEGF, GLUT1, EPO)

    • HIF-1α nuclear localization by immunohistochemistry

  • Epigenetic Regulation:

    • Succinate inhibits α-ketoglutarate-dependent dioxygenases including TET enzymes

    • DNA methylation profiling

    • Histone modification analysis (H3K27me3, H3K4me3)

  • Reactive Oxygen Species (ROS) Signaling:

    • Complex II dysfunction increases ROS production

    • Oxidative stress marker measurement (4-HNE, protein carbonylation)

    • Antioxidant response pathway activation (Nrf2 targets)

  • Metabolic Adaptation Pathways:

    • AMPK activation status

    • mTOR signaling assessment

    • Autophagy marker analysis

Understanding these pathways in zebrafish models may reveal therapeutic targets for preventing progression to tumor formation in SDHB-deficient states . Comparative analysis between heterozygous and homozygous mutants could identify critical thresholds in these pathways that trigger pathological changes.

How can researchers ensure reproducibility in zebrafish sdhdb studies?

To maximize reproducibility in zebrafish sdhdb research:

  • Standardized Protocol Documentation:

    • Detailed reporting of housing conditions, including stocking density, water parameters, and feeding regimens

    • Clear documentation of genetic background and breeding schemes

    • Comprehensive experimental protocols with timing information

  • Sex-Specific Analysis:

    • Always analyze data by sex, as females exhibit different anxiety-like behaviors than males

    • Report sex ratios in experimental groups

  • Environmental Control:

    • Monitor and report noise levels, as they significantly impact behavior

    • Control for vibration, light intensity, and water parameters

    • Conduct behavioral testing in separate rooms when possible

  • Statistical Considerations:

    • Power analysis to determine appropriate sample sizes

    • Mixed-effects models to account for tank effects and individual variation

    • Transparent reporting of outlier handling and exclusion criteria

  • Genetic Verification:

    • Regular genotyping to confirm mutation status

    • Assessment of genetic drift in maintained lines

    • Baseline characterization of metabolic parameters in each generation

The global collaborative approach used in recent zebrafish research demonstrates that accounting for laboratory-specific variables can significantly improve understanding of factors affecting experimental outcomes .

What antibody-based techniques are available for detecting zebrafish sdhdb protein?

Several antibody-based approaches can be employed for sdhdb detection:

TechniqueApplicationDetection SensitivityConsiderations
Western Blot (WB)Protein expression levels, molecular weight confirmationModerate to highRequires proper protein extraction methods for membrane proteins
ELISAQuantitative protein measurementHighCommercial kits available with rabbit polyclonal antibodies against zebrafish sdhdb
Immunohistochemistry (IHC)Tissue localizationModerateFixation protocol optimization critical for mitochondrial proteins
ImmunofluorescenceSubcellular localizationHighCan be combined with mitochondrial markers
Proximity Ligation AssayProtein-protein interactionsVery highUseful for studying sdhdb incorporation into Complex II

Rabbit polyclonal antibodies against Danio rerio sdhdb are commercially available with verified reactivity for applications including ELISA and Western Blot . For optimal results, antigen-affinity purified antibodies are recommended, especially for localization studies where specificity is paramount.

What future research directions could advance sdhdb-related disease understanding?

Promising future research directions include:

  • Multi-Omics Integration:
    Combining transcriptomics, proteomics, and metabolomics data from sdhdb mutant zebrafish to build comprehensive models of metabolic rewiring.

  • Single-Cell Analysis:
    Characterizing cell-type specific responses to sdhdb deficiency to understand differential tissue vulnerability.

  • Environmental Triggers:
    Investigating environmental factors that might trigger tumor formation in heterozygous sdhdb mutants to explain incomplete penetrance.

  • Compensatory Mechanism Identification:
    Exploring why heterozygous sdhdb zebrafish show biochemical alterations but limited tumor formation, potentially revealing protective mechanisms.

  • Therapeutic Approaches:

    • Metabolic interventions targeting succinate accumulation

    • Epigenetic modifiers to counteract succinate-induced epigenetic changes

    • Antioxidants to mitigate oxidative stress

    • HIF inhibitors to block pseudohypoxic signaling

  • Gene-Environment Interaction Studies:
    Examining how environmental stressors (temperature, toxins, oxygen levels) interact with sdhdb mutations to influence phenotypic outcomes.

These directions build on the established zebrafish model of sdhdb deficiency and aim to translate findings into potential therapeutic approaches for human SDHB-related diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.