Recombinant Danio rerio Surfeit locus protein 4 (surf4)

Shipped with Ice Packs
In Stock

Description

Role in Protein Trafficking

Surf4 is a conserved cargo receptor in the endoplasmic reticulum (ER) and ER-Golgi intermediate compartment (ERGIC). It facilitates ER export of soluble proteins by binding amino-terminal tripeptide motifs (ER-ESCAPE motifs), prioritizing cargo prone to aggregation (e.g., dentin sialophosphoprotein) . Surf4 interacts with ERGIC-53 and p24 proteins to stabilize COPII/COPI vesicle dynamics, maintaining Golgi integrity .

Lipid Metabolism and Disease Links

  • Chylomicron Secretion: Intestinal Surf4 deficiency in mice impairs lipid absorption, causing lipid droplet accumulation in enterocytes and reduced serum triglycerides/cholesterol .

  • Therapeutic Target: Surf4 regulates PCSK9 and ApoB secretion, linking it to dyslipidemia, atherosclerosis, and Anderson’s disease . Homozygous surf4 knockout mice exhibit embryonic lethality, underscoring its developmental necessity .

  • Cancer: Overexpression correlates with poor survival in brain/breast cancers and lymphoma, suggesting oncogenic potential .

Viral Replication

Surf4 supports replication of positive-strand RNA viruses (e.g., hepatitis C) by aiding double-membrane vesicle formation .

Applications in Research

  • Antibody Development: Rabbit polyclonal antibodies targeting Surf4’s N-terminal region (e.g., ABIN2784078) enable Western blotting across species, including zebrafish .

  • Protein Interaction Studies: Used to investigate binding partners like STIM1, which modulates calcium signaling .

  • Drug Discovery: Explored for targeting dyslipidemia, viral infections, and cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
surf4; Surfeit locus protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
surf4
Target Protein Sequence
MGQEDMMSAAEDLADQFLRVTKQYLPHMARLCLISTFLEDGIRMWFQWSEQRDYIEATWS CGYFLATCFVIINLIGQIGGCVLVLSRNLVQYACFGLFCIIALQTVAYSILWDLKFLMRN LALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSDFF SILQNMVGTALIILVAVGFKTKLAALTLVVWLLAINVYFNAFWTVPAYKPMHDFLKYDFF QTTSVIGGLLLVVALGPGGVSMDEKKKEW
Uniprot No.

Target Background

Function
Endoplasmic reticulum cargo receptor that mediates the export of lipoproteins by recruiting cargos into COPII vesicles to facilitate their secretion. It acts as a cargo receptor for lipoproteins carrying both APOB and APOA1, thereby regulating lipoprotein delivery and maintaining lipid homeostasis.
Database Links
Protein Families
SURF4 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Surfeit locus protein 4 (surf4) and what is its role in zebrafish?

Surfeit locus protein 4 (surf4) in Danio rerio functions as a transmembrane cargo receptor that primarily binds amino-terminal tripeptide motifs of secreted proteins. It plays a critical role in the endoplasmic reticulum (ER) to Golgi trafficking system, specifically facilitating the movement of soluble cargo proteins through the secretory pathway . The protein is considered a housekeeping gene in higher eukaryotes and is expressed as a netlike structure that includes punctate colocalization with the ER exit site (ERES) marker Sec23 . In zebrafish, as in other vertebrates, surf4 mediates the efficient export of specific cargo proteins from the ER, which is essential for normal cellular function and development. Knockout studies in other models suggest that while cells can remain viable without surf4, they exhibit altered protein trafficking dynamics and slightly reduced growth rates .

What is the structural composition of recombinant Danio rerio surf4 protein?

The recombinant full-length Danio rerio surf4 protein (Q7SZQ7) consists of 269 amino acids and is typically produced with an N-terminal His tag when expressed in E. coli expression systems . Structurally, surf4 is a transmembrane protein with multiple transmembrane domains that anchor it within the ER membrane, allowing it to function as a cargo receptor . Recent structural predictions suggest that surf4 contains specific cytoplasmic regions, including a loop between transmembrane helices 4 and 5 (termed the Phe-loop) and important motifs in the C-terminal tail that are critical for its interactions with the COPII coat complex . The protein contains a COPI vesicle-associated recycling motif near its carboxy-terminus, which includes three lysine residues that, when mutated (particularly when two of the three lysines are changed to alanines), significantly alter its localization pattern within the cell . Understanding this structural composition is essential for designing experiments that probe surf4's function in the secretory pathway.

What expression systems are most efficient for producing recombinant Danio rerio surf4?

E. coli expression systems have been successfully used to produce recombinant full-length Danio rerio surf4 protein with N-terminal His tags, providing sufficient yields for biochemical and structural studies . When designing expression constructs, it is important to include the full protein sequence (1-269aa) to maintain proper folding and functionality . For cellular studies examining localization and trafficking functions, mammalian expression systems using plasmid transfection into cell lines such as HEK293A have proven effective for producing HA-tagged surf4 constructs that maintain proper localization and function . These mammalian expression systems are particularly valuable when studying surf4 interactions with other components of the cellular trafficking machinery or when performing rescue experiments in surf4 knockout cells . The choice between bacterial and mammalian expression systems should be guided by the specific experimental requirements, with bacterial systems favored for protein purification and biochemical studies, while mammalian systems are preferred for cellular and functional analyses.

How does surf4 recognize and bind to specific cargo proteins in the ER?

Surf4 specifically recognizes and binds to amino-terminal tripeptide motifs of secreted proteins, with particular affinity for motifs containing a hydrophobic amino acid followed by proline and another hydrophobic amino acid (Φ-P-Φ) . This recognition mechanism is evolutionarily conserved, as demonstrated by the ability of yeast Erv29p (a homolog of surf4) to rescue trafficking defects in surf4 knockout mammalian cells . The binding specificity extends beyond the strict Φ-P-Φ motif, as proteins with similar N-terminal tripeptides lacking one hydrophobic amino acid (FPT), containing serine instead of proline at position 2 (ISV), or lacking both the proline and one hydrophobic amino acid (RSV) can still be rescued in their trafficking by surf4 . Importantly, proteins that should remain in the ER, such as chaperones, typically have N-terminal sequences that prevent binding to surf4, often characterized by acidic amino acids within their starting tripeptide or rare position 2 prolines . This selective binding mechanism ensures that only appropriate cargo proteins are exported from the ER, while resident proteins are retained.

What methodologies are most effective for studying surf4 interactions with COPII coat proteins?

The NanoBiT assay has proven effective for studying the interactions between surf4 and SEC24 adaptor proteins of the COPII coat complex . This approach allows researchers to identify specific domains of surf4 that engage with different SEC24 paralogs, providing insights into the mechanisms of cargo selection and export . Site-directed mutagenesis guided by structural predictions and evolutionary conservation has been successfully employed to identify critical residues in surf4 that mediate these interactions, particularly in cytoplasmic regions like the Phe-loop between transmembrane helices 4 and 5 and in the C-terminal tail . Co-immunoprecipitation experiments combined with western blotting can further validate these interactions in cellular contexts . For visualizing the localization and trafficking dynamics of surf4, confocal microscopy using fluorescently labeled antibodies against endogenous surf4 or epitope-tagged recombinant surf4 (e.g., HA-surf4) provides high-resolution images of its distribution within cellular compartments . These complementary approaches allow researchers to build a comprehensive understanding of how surf4 engages with the COPII machinery to facilitate cargo export from the ER.

What phenotypic changes are observed in Danio rerio cells following surf4 knockout?

CRISPR/Cas9-mediated knockout of surf4 in cellular models results in viable cells with only slightly slower growth rates than their parent cells, suggesting that while surf4 is important, it is not absolutely essential for basic cellular viability . The most prominent phenotypic changes involve alterations in protein trafficking, with specific cargo proteins that normally depend on surf4 for efficient ER export showing accumulation within the ER rather than reaching their target destinations . In surf4 knockout cells, affected proteins such as prosaposin and progranulin are no longer efficiently transported to lysosomes and instead build up within the ER, often forming concentrated foci that are visible by immunofluorescence microscopy . Biochemical analysis using Endoglycosidase H (Endo H) sensitivity assays reveals an increased abundance of Endo H-sensitive (ER-resident) forms of these proteins in surf4 knockout cells, providing further evidence of their impaired trafficking through the secretory pathway . The formation of protein aggregates in the ER of surf4 knockout cells, particularly for proteins with specific N-terminal tripeptide motifs, indicates that surf4 plays an important role in preventing the aggregation of its client proteins during ER export .

How do mutations in the COPI recycling motif of surf4 affect its localization and function?

Mutations in the COPI recycling motif near the carboxy-terminus of surf4, particularly replacement of two of three lysines with alanines (creating the HA-Surf4-AAK variant), significantly alter its subcellular distribution . While wild-type surf4 shows only low-to-modest residence in the cis-Golgi, the AAK mutant exhibits greatly increased localization to this compartment, suggesting impaired retrieval from the Golgi to the ER . This altered localization pattern is likely due to disruption of the interaction between the lysine-rich motif and COPI vesicles, which normally mediate retrograde transport from the Golgi to the ER . Functionally, these mutations could potentially impact the efficiency of cargo cycling and export, as proper recycling of surf4 is likely essential for maintaining optimal cargo flux through the early secretory pathway . Researchers investigating surf4 function should consider the impact of such mutations when designing experiments, particularly when using tagged constructs that might interfere with the COPI recycling motif. The strategic mutation of this motif can also serve as a valuable tool for increasing the residence time of surf4 in specific compartments for localization or interaction studies .

What is the optimal protocol for expressing and purifying recombinant Danio rerio surf4 protein?

For successful expression and purification of recombinant Danio rerio surf4 protein, an E. coli expression system using a construct containing the full-length protein (1-269aa) with an N-terminal His tag has proven effective . The expression protocol typically involves transformation of the construct into a suitable E. coli strain, induction of protein expression with IPTG, and growth at reduced temperatures (often 18-25°C) to enhance proper folding of the transmembrane protein . Purification should begin with cell lysis under conditions that solubilize membrane proteins, typically using detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations above their critical micelle concentration . The His-tagged protein can then be purified using immobilized metal affinity chromatography (IMAC), with imidazole gradients for elution, followed by size exclusion chromatography to remove aggregates and ensure homogeneity . To maintain the native conformation of surf4 throughout the purification process, it is crucial to keep the protein in the presence of appropriate detergents or lipid nanodiscs, as complete removal of these amphipathic molecules can lead to protein aggregation and loss of function .

How can researchers effectively analyze the cargo selectivity of surf4 in zebrafish models?

To analyze cargo selectivity of surf4 in zebrafish models, researchers should employ a multi-faceted approach combining in vivo and in vitro techniques. In vitro binding assays using purified recombinant surf4 and synthetic peptides representing various N-terminal tripeptide motifs can provide quantitative data on binding affinities and specificities . These assays can be complemented by cellular approaches using CRISPR/Cas9-generated surf4 knockout zebrafish cells, followed by rescue experiments with wild-type or mutant surf4 constructs . To identify endogenous cargo proteins that depend on surf4 for efficient trafficking, researchers can compare the secretomes of wild-type and surf4 knockout cells using quantitative proteomics, focusing on proteins that show significantly reduced secretion in the absence of surf4 . In vivo approaches might include generating conditional surf4 knockout zebrafish using tissue-specific Cre-lox systems, followed by analysis of protein localization using immunohistochemistry and trafficking defects using pulse-chase experiments . Researchers should pay particular attention to proteins with N-terminal tripeptide motifs that match the Φ-P-Φ pattern or its variants, as these are likely to be surf4-dependent cargoes .

What experimental designs are suitable for investigating the interaction between surf4 and SEC24 paralogs?

To investigate the interactions between surf4 and different SEC24 paralogs, researchers should design experiments that can detect specific protein-protein interactions while maintaining the native membrane environment of surf4. The NanoBiT protein complementation assay has been successfully used for this purpose, allowing detection of interactions between surf4 and SEC24 paralogs in living cells . This approach involves fusing complementary fragments of NanoLuc luciferase to surf4 and various SEC24 paralogs, with luminescence signal generated upon protein interaction . To identify specific interaction domains, researchers should perform extensive site-directed mutagenesis of surf4, focusing on predicted cytoplasmic regions such as the Phe-loop between transmembrane helices 4 and 5 and the C-terminal tail . Validation of these interactions can be achieved through co-immunoprecipitation experiments, pulling down epitope-tagged surf4 and probing for co-precipitated SEC24 paralogs . Advanced approaches may include proximity labeling techniques such as BioID or TurboID, where a promiscuous biotin ligase fused to surf4 can biotinylate proximal proteins, allowing for identification of the SEC24 interaction network under various conditions . Cryo-electron microscopy or X-ray crystallography of purified complexes would provide the highest resolution data on these interactions, though these approaches present significant technical challenges for membrane protein complexes .

How can researchers quantitatively assess trafficking defects in surf4 knockout models?

Quantitative assessment of trafficking defects in surf4 knockout models requires multiple complementary approaches to measure protein movement through the secretory pathway. Pulse-chase experiments using radioactive labeling or fluorescent protein timers can track the kinetics of cargo protein transport from the ER to the Golgi and beyond . These experiments should focus on known surf4 client proteins, such as those with appropriate N-terminal tripeptide motifs . Endo H sensitivity assays provide a biochemical measure of how efficiently proteins move from the ER to the Golgi, as N-linked glycans become resistant to Endo H digestion after processing in the Golgi . In surf4 knockout cells, an increased proportion of Endo H-sensitive forms indicates impaired ER-to-Golgi trafficking . Quantitative immunofluorescence microscopy with organelle-specific markers can measure the relative distribution of cargo proteins across different compartments, with colocalization analysis providing statistical measures of trafficking defects . For secreted proteins, quantitative proteomics of conditioned media from wild-type versus surf4 knockout cells can identify proteins whose secretion is impaired . Live-cell imaging using fluorescently tagged cargo proteins allows for real-time visualization and quantification of trafficking dynamics, particularly when combined with photoactivatable or photoconvertible fluorophores that enable pulse-chase-like experiments with high spatial and temporal resolution .

How should researchers interpret changes in surf4 localization patterns following experimental manipulations?

When interpreting changes in surf4 localization patterns following experimental manipulations, researchers should consider multiple cellular compartments and employ co-localization with established markers of the secretory pathway. Normal surf4 distribution shows strongest signals at punctate structures positive for the ERES marker Sec23, with additional weblike structures surrounding ERES, moderate colocalization with the ERGIC marker ERGIC-53, and only low levels of colocalization with the cis-Golgi marker giantin . Increased localization to the cis-Golgi, as observed with COPI recycling motif mutations (HA-Surf4-AAK), suggests impaired retrograde transport from the Golgi to the ER . Accumulation in the rough ER or ER quality control domain, which is not typical for wild-type surf4, may indicate defects in protein folding or forward trafficking . Quantitative analysis should include Pearson's correlation coefficients or Manders' overlap coefficients to measure co-localization with different compartment markers, and these should be calculated from multiple cells across independent experiments to ensure statistical reliability . Changes in localization patterns should be interpreted in the context of potential effects on surf4 function, considering that proper localization is likely essential for its role in cargo selection and ER export .

What are common technical challenges in working with recombinant surf4 and how can they be addressed?

Working with recombinant surf4 presents several technical challenges that researchers should anticipate and address in their experimental designs. As a transmembrane protein, surf4 requires detergents or lipid environments for stability during purification and biochemical studies, with improper detergent selection often leading to protein aggregation or loss of function . This can be addressed by screening multiple detergents and optimizing buffer conditions, or by employing nanodiscs or liposomes to maintain a lipid bilayer environment . Expression levels in heterologous systems may be limited by the capacity of the host cell to properly fold and insert membrane proteins, which can be improved by using specialized E. coli strains (such as C41(DE3) or C43(DE3)), lower induction temperatures, or eukaryotic expression systems for more complex studies . When performing cellular localization studies, overexpression of recombinant surf4 may alter its normal distribution pattern or cause aggregation, requiring careful titration of expression levels and confirmation with endogenous protein localization . For interaction studies, the membrane-embedded nature of surf4 may hinder accessibility of interaction domains, necessitating the use of techniques specifically designed for membrane protein interactions, such as membrane yeast two-hybrid systems or proximity labeling approaches .

How can researchers distinguish between direct and indirect effects of surf4 knockout on protein trafficking?

Distinguishing between direct and indirect effects of surf4 knockout on protein trafficking requires carefully designed rescue experiments and cargo specificity analyses. Direct effects would involve proteins that directly bind to surf4 through their N-terminal tripeptide motifs, while indirect effects might result from broader disruption of the secretory pathway or from secondary changes in cell physiology . To identify direct surf4 client proteins, researchers should perform rescue experiments in surf4 knockout cells, reintroducing wild-type surf4 to see which trafficking defects are corrected . Proteins whose trafficking is rescued are likely direct surf4 clients. In vitro binding assays using purified recombinant surf4 and potential cargo proteins or peptides representing their N-terminal sequences can provide direct evidence of physical interaction . Mutation of the N-terminal tripeptide motifs in potential cargo proteins should abolish their interaction with surf4 and their efficient trafficking, providing further evidence of a direct relationship . Comparative analyses across multiple potential cargo proteins can reveal patterns in trafficking defects, with direct surf4 clients likely showing similar kinetics of accumulation in the ER following surf4 knockout . Examination of early versus late trafficking defects using time-course experiments can help distinguish primary (direct) from secondary (indirect) effects, with direct surf4 clients showing immediate impairment in ER export .

What analysis tools are most appropriate for quantifying surf4-dependent protein export efficiency?

For quantifying surf4-dependent protein export efficiency, researchers should employ multiple complementary analytical approaches to generate robust data. Pulse-chase experiments combined with immunoprecipitation and SDS-PAGE analysis allow for quantitative measurement of how quickly newly synthesized proteins exit the ER, with densitometric analysis of Endo H-sensitive versus Endo H-resistant bands providing a quantitative measure of ER-to-Golgi transport rates . High-content imaging with automated analysis can quantify the subcellular distribution of cargo proteins across hundreds of cells, measuring parameters such as the ratio of ER to Golgi fluorescence intensity or the formation of ER aggregates in surf4 knockout cells . For secreted proteins, ELISA or mass spectrometry-based quantification of conditioned media can measure absolute secretion rates, while intracellular retention can be quantified by western blotting of cell lysates . Live-cell imaging with fluorescence recovery after photobleaching (FRAP) or fluorescence loss in photobleaching (FLIP) can provide dynamic measurements of protein movement between compartments . Computational tools such as CellProfiler or specialized ImageJ plugins can automate the analysis of microscopy data, allowing for unbiased quantification of trafficking parameters across large datasets . Statistical analysis should include appropriate tests for significance, such as ANOVA or t-tests, with multiple biological replicates to ensure reproducibility .

What are the most promising approaches for investigating surf4 function in zebrafish development?

Investigating surf4 function in zebrafish development presents unique opportunities due to the model organism's transparency and rapid external development. CRISPR/Cas9 genome editing could generate zebrafish with complete surf4 knockout or with specific mutations in functional domains, allowing assessment of developmental phenotypes and potential compensatory mechanisms . Conditional knockout strategies using tissue-specific promoters driving Cre recombinase expression in floxed surf4 zebrafish would enable examination of surf4 function in specific tissues or developmental stages, circumventing potential early lethality of complete knockout . High-resolution in vivo imaging of fluorescently tagged surf4 and its cargo proteins in transparent zebrafish embryos could provide unprecedented insights into trafficking dynamics during development . Single-cell RNA sequencing of different cell types and developmental stages in wild-type versus surf4-mutant zebrafish could identify cell-specific consequences of surf4 dysfunction and potential transcriptional compensation mechanisms . Proteomic analysis of the secretome from different tissues in surf4-mutant zebrafish would reveal the spectrum of proteins whose secretion depends on surf4 in different developmental contexts . These approaches, combined with detailed phenotypic characterization, would significantly advance our understanding of how surf4-mediated protein trafficking contributes to normal zebrafish development.

How might surf4 function as part of larger protein complexes in the early secretory pathway?

Recent evidence suggests that surf4 functions within a complex network of interactions in the early secretory pathway, beyond its direct role in binding cargo proteins via N-terminal tripeptide motifs. Surf4 interacts with the COPII coat through specific domains that engage different SEC24 paralogs, suggesting that it may participate in forming specialized export complexes tailored to different cargo types . There is evidence that surf4 may work cooperatively with other cargo receptors such as TMED10, particularly in the transport of complex cargoes like PCSK9, where TMED10's GOLD domain binds to the precursor form before surf4 engagement . Future research should investigate potential higher-order assemblies containing surf4 and other components of the early secretory pathway, possibly using techniques such as blue native PAGE, chemical crosslinking combined with mass spectrometry, or cryo-electron tomography of intact cellular regions . The potential role of surf4 in organizing specialized ER exit sites for specific cargo types represents another important avenue for investigation, particularly given its punctate colocalization with ERES markers . Understanding how surf4 functions within these larger complexes would provide important insights into the organization and regulation of the early secretory pathway and how cargo specificity is achieved in this complex trafficking system.

What computational approaches could improve prediction of surf4-dependent cargo proteins?

Advanced computational approaches could significantly enhance our ability to predict surf4-dependent cargo proteins based on their N-terminal sequence motifs and other features. Machine learning algorithms trained on known surf4 client proteins could identify subtle patterns beyond the basic Φ-P-Φ tripeptide motif, potentially accounting for the influence of downstream amino acids or secondary structure elements on surf4 binding . Molecular dynamics simulations of surf4-peptide interactions could provide atomic-level insights into the structural basis of cargo recognition, helping to refine prediction algorithms . Integration of evolutionary conservation data across species could identify highly conserved features of surf4-dependent cargo proteins, improving prediction accuracy . Protein-protein interaction network analysis incorporating high-throughput experimental data could reveal additional factors that influence surf4-cargo interactions in the cellular context . Development of specialized databases and web tools that allow researchers to input protein sequences and receive predictions about their likelihood of being surf4-dependent would accelerate discovery in the field . These computational approaches, when combined with experimental validation, would provide a more comprehensive understanding of the rules governing surf4-cargo selectivity and enable more accurate prediction of the full range of surf4-dependent proteins across different species and cell types.

Comparative Analysis Table: Surf4 Across Species

SpeciesProtein LengthKey Structural FeaturesPrimary LocalizationMajor Cargo TypesKnockout PhenotypeReference
Danio rerio (Zebrafish)269 aaN-terminal cargo binding domain, Multiple transmembrane domains, C-terminal COPI recycling motifERES, ERGICProteins with Φ-P-Φ-like N-terminal tripeptidesNot fully characterized in vivo
Saccharomyces cerevisiae (Erv29p)~35 kDaSimilar domain organization to vertebrate Surf4ERES, early GolgiGlycosylated pro-α-factorViable, decreased secretion efficiency
Homo sapiens~30 kDaPhe-loop between TM4-5, Important motifs in C-terminal tailERES, ERGICPCSK9, Cab45, proteins with Φ-P-Φ motifsViable cells with trafficking defects
DrosophilaNot specifiedConserved with vertebrate Surf4Not fully characterizedNot fully characterizedLethal

This table provides a comparative overview of Surf4 across different species, highlighting conservation and divergence in structural features, localization patterns, cargo specificity, and knockout phenotypes. The data demonstrates the evolutionary conservation of Surf4's core function as a cargo receptor in the early secretory pathway, while also revealing species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.