Recombinant Danio rerio Synapse differentiation-inducing gene protein 1-like (syndig1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
syndig1l; si:ch211-146n9.2; si:dkey-263b2.1; Synapse differentiation-inducing gene protein 1-like; Capucin; Dispanin subfamily C member 1; DSPC1; Transmembrane protein 90A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
syndig1l
Target Protein Sequence
MESLSELQNPLLDKNSKHMVMADYGYGGDFHSNQYQENIINYFVTGGGGGGGGGGGGGGV AVTGGNGKAKSQLLDATSLHLAVEAFYKPNFILYKDDVSGKGKDYKNECCETTFMEKKDK EVVVETPSTEDPQAKLLDENDVKIQTVSYEVEEEEYVEYETDCSSDSESEDNFIVIPPRD HLGLAIFSMLCCFWPLGIAAFYFSQGTSKAVTKGDFPLASIASRRALFLAALSITIGTGV YVGVVVALIAYLSKPGHI
Uniprot No.

Target Background

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network.

Q&A

What is Synapse differentiation-inducing gene protein 1-like (syndig1l) in Danio rerio?

Synapse differentiation-inducing gene protein 1-like (syndig1l) is a transmembrane protein in zebrafish (Danio rerio) with significant homology to mammalian SYNDIG1L proteins. It is also known by alternative names including Capucin and Transmembrane protein 90A (TMEM90A) . The protein is 258 amino acids in length in its full form and is thought to play roles in synapse formation and function, similar to its mammalian orthologues . While less extensively characterized than some synaptic proteins like SYNGAP1, syndig1l likely contributes to neural development and synaptic plasticity in the zebrafish model system.

How does zebrafish syndig1l relate structurally to mammalian orthologues?

Zebrafish syndig1l shares significant structural features with mammalian orthologues, though with species-specific variations. The full-length zebrafish syndig1l protein consists of 258 amino acids, which differs slightly from human (238 amino acids) and mouse (237 amino acids) versions . These differences may reflect evolutionary adaptations specific to teleost fish. The protein likely maintains conserved transmembrane domains and functional motifs associated with synaptic localization and protein-protein interactions, though detailed structural analyses comparing the species variations would require crystallographic studies not yet evident in available literature.

What expression patterns does syndig1l exhibit during zebrafish development?

While the search results don't provide specific developmental expression data for syndig1l in zebrafish, researchers investigating this question would typically employ techniques such as whole-mount in situ hybridization, quantitative RT-PCR at different developmental stages, or transgenic reporter lines. Based on its mammalian orthologues and its putative role in synapse development, expression would likely initiate during neurogenesis and continue throughout periods of active synaptogenesis. A comprehensive developmental expression analysis would include examination of tissue-specific expression in neural tissues, potential differential expression between brain regions, and temporal dynamics from early embryonic stages through adulthood.

What are the optimal storage conditions for recombinant Danio rerio syndig1l protein?

Recombinant Danio rerio syndig1l protein requires specific storage conditions to maintain stability and activity. For long-term storage, the protein should be kept at -20°C/-80°C, with expected shelf life varying by preparation format—6 months for liquid formulations and 12 months for lyophilized preparations . To minimize degradation, it's recommended to aliquot the protein and avoid repeated freeze-thaw cycles. For shorter working periods (up to one week), aliquots can be stored at 4°C . Researchers should also consider adding glycerol (recommended at 5-50% final concentration, with 50% being the default) as a cryoprotectant when preparing storage aliquots . These storage parameters are critical for experimental reproducibility and should be documented in materials and methods sections of publications.

What reconstitution protocols are recommended for lyophilized recombinant syndig1l?

For optimal reconstitution of lyophilized recombinant syndig1l, the following methodological approach is recommended:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom of the container

  • Reconstitute the protein in deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) to enhance protein stability

  • Aliquot the reconstituted protein into smaller volumes suitable for single-use experiments to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

This reconstitution protocol helps maintain protein structure and function while minimizing degradation. Researchers should verify protein integrity after reconstitution through SDS-PAGE or functional assays appropriate to their experimental design.

How can researchers verify the purity and integrity of recombinant syndig1l preparations?

Verification of recombinant syndig1l purity and integrity requires a multi-faceted approach. Commercial preparations typically guarantee >85% purity as determined by SDS-PAGE , but researchers should independently confirm this upon receipt. A comprehensive verification protocol includes:

  • SDS-PAGE analysis with Coomassie or silver staining to assess purity and approximate molecular weight

  • Western blotting using specific antibodies against syndig1l or epitope tags (such as His-tags commonly used in recombinant preparations )

  • Mass spectrometry for precise molecular weight determination and potential identification of post-translational modifications

  • Functional assays based on known biochemical properties or binding interactions of syndig1l

  • For His-tagged preparations, nickel chelation assays to confirm tag accessibility

Degradation products or aggregates can significantly impact experimental outcomes, so verification steps should be performed before commencing key experiments and periodically during long-term storage.

What are the key considerations for designing in vitro binding studies with syndig1l?

Designing robust in vitro binding studies with syndig1l requires careful consideration of several technical aspects:

  • Protein orientation and tag interference: Since syndig1l is a transmembrane protein, the positioning of affinity tags (such as the His-tag used in recombinant preparations ) must be considered to avoid interfering with binding domains. N- or C-terminal tags may differentially affect binding properties.

  • Membrane context: As a transmembrane protein, syndig1l's native conformation and binding properties may depend on a lipid environment. Consider using liposomes, nanodiscs, or detergent micelles to mimic membrane conditions.

  • Binding partners: Based on its putative role in synapse differentiation, potential binding partners may include scaffolding proteins, receptors, or signaling molecules. Begin with candidate-based approaches informed by mammalian orthologues.

  • Detection methods: Options include ELISA, surface plasmon resonance (SPR), microscale thermophoresis (MST), or pull-down assays followed by immunoblotting.

  • Controls: Include negative controls (unrelated proteins) and competition assays to confirm binding specificity.

These considerations should be systematically addressed during experimental design to ensure physiologically relevant and reproducible binding data.

How can zebrafish syndig1l be used in comparative studies with mammalian orthologues?

Zebrafish syndig1l offers valuable opportunities for comparative studies with mammalian orthologues, particularly for evolutionary and functional conservation analyses. A methodological approach would include:

  • Sequence and structural comparisons: Align full-length sequences of zebrafish syndig1l (258 amino acids) with human (238 amino acids) and mouse (237 amino acids) orthologues to identify conserved domains, motifs, and putative functional regions.

  • Expression system standardization: Express recombinant proteins from different species under identical conditions (e.g., same E. coli strain or mammalian cell line ) to minimize system-dependent variations.

  • Interspecies complementation studies: Test whether zebrafish syndig1l can rescue phenotypes in mammalian cells with SYNDIG1L knockdown/knockout, and vice versa.

  • Binding partner conservation: Compare the interactomes of syndig1l across species using affinity purification-mass spectrometry approaches.

  • Functional domain swapping: Create chimeric proteins with domains exchanged between zebrafish and mammalian orthologues to identify functionally critical regions.

This comparative approach can reveal evolutionarily conserved mechanisms of syndig1l function and species-specific adaptations, contributing to our understanding of synaptic protein evolution.

What genetic approaches can be used to study syndig1l function in zebrafish models?

Several sophisticated genetic approaches can be employed to investigate syndig1l function in zebrafish:

  • CRISPR/Cas9 genome editing: Design guide RNAs targeting critical exons of syndig1l to generate frameshift mutations or specific amino acid substitutions. This approach has been successfully used for other synaptic proteins in zebrafish, such as syngap1a and syngap1b .

  • Conditional knockout strategies: Implement systems like Cre-loxP or GAL4-UAS to achieve tissue-specific or temporally controlled syndig1l disruption, allowing for the study of region-specific functions while avoiding developmental compensation.

  • Knock-in reporter lines: Generate fluorescent protein fusions to monitor syndig1l expression patterns, subcellular localization, and protein dynamics in vivo.

  • Morpholino antisense oligonucleotides: For temporary knockdown during early developmental stages, particularly useful for initial phenotypic screening.

  • Transgenic rescue experiments: Reintroduce wild-type or mutated versions of syndig1l in knockout backgrounds to assess functional domains and conduct structure-function analyses.

Each approach has specific advantages and limitations that should be considered based on the research question, with particular attention to potential off-target effects and compensation mechanisms.

What behavioral assays can assess phenotypes related to syndig1l dysfunction in zebrafish?

Given syndig1l's putative role in synaptic function, several zebrafish behavioral assays could detect phenotypes associated with its dysfunction:

  • Locomotor activity analysis: Quantify baseline swimming patterns and responses to stimuli using automated tracking systems, similar to assessments done for syngap1ab mutant zebrafish that demonstrated context-dependent hyperactivity .

  • Acoustic startle response (ASR): Measure the response to vibration stimuli, which tests sensorimotor integration and has been standardized for neurological phenotyping in zebrafish .

  • Visual-motor response (VMR): Analyze reactions to light-dark transitions, which can reveal abnormalities in visual processing and motor output integration .

  • Habituation protocols: Implement repeated stimulation paradigms to assess how quickly fish adapt to stimuli, potentially revealing learning deficits .

  • Social behavior testing: Evaluate shoaling behavior and social preference, which may be affected if syndig1l plays roles in circuits governing social cognition.

  • Anxiety-related behaviors: Assess thigmotaxis (edge preference) and depth preference in novel tank tests.

For rigorous assessment, these assays should be performed across different developmental stages and environmental contexts, as neurological phenotypes may be context-dependent, as observed with syngap1 mutations .

What approaches can identify the molecular pathways and interactome of syndig1l in zebrafish?

To comprehensively characterize the molecular pathways and interactome of syndig1l in zebrafish, researchers should employ a multi-faceted approach:

  • Proximity labeling proteomics: Implement BioID or APEX2 fusion constructs with syndig1l to identify proximal proteins in living zebrafish neurons, providing spatially resolved interactome data.

  • Co-immunoprecipitation coupled with mass spectrometry: Isolate syndig1l protein complexes from zebrafish brain tissue or relevant cell lines using antibodies or epitope-tagged constructs (such as His-tagged syndig1l ), followed by mass spectrometric identification of binding partners.

  • Yeast two-hybrid screening: Using syndig1l domains as bait against zebrafish cDNA libraries to identify direct protein-protein interactions.

  • Phosphoproteomics: Compare phosphorylation profiles between wild-type and syndig1l-deficient samples to identify affected signaling cascades.

  • Transcriptomics: Perform RNA-seq on specific neural populations in wild-type versus syndig1l mutant zebrafish to identify dysregulated gene expression networks.

  • Comparative interactomics: Cross-reference identified interactions with known mammalian orthologues to build evolutionary conservation maps of syndig1l functions.

This systematic approach would generate a comprehensive understanding of syndig1l's role in cellular signaling networks and identify potential therapeutic targets for related neurological conditions.

How does syndig1l compare functionally to other synaptic proteins like SYNGAP1 in zebrafish models?

While direct comparative studies between syndig1l and SYNGAP1 in zebrafish are not evident in the provided search results, a methodological approach to such comparison would involve several parallel analyses:

  • Expression pattern comparison: Map the temporal and spatial expression of both proteins during development and in adult brain regions to identify areas of overlap or distinction.

  • Subcellular localization analysis: Determine whether syndig1l and SYNGAP1 localize to the same synaptic compartments through immunohistochemistry or fluorescent protein tagging.

  • Electrophysiological phenotyping: Compare synaptic transmission parameters (mEPSCs, paired-pulse ratios, LTP/LTD) in respective mutant lines to identify shared or divergent effects on synaptic function.

  • Behavioral phenotype comparison: Assess whether syndig1l mutants show hyperactivity patterns similar to those observed in syngap1ab mutant zebrafish, which display context-dependent hyperactivity particularly pronounced in low-arousal environments .

  • Double mutant analysis: Generate and characterize syndig1l/syngap1 double mutants to identify genetic interactions, which could reveal functional relationships or compensatory mechanisms.

This comparative approach would be valuable for understanding the broader organization of synaptic protein networks and their respective contributions to neural circuit function.

What is the recommended experimental design for studying syndig1l in neurodevelopmental disorder models?

For studying syndig1l in the context of neurodevelopmental disorders, a comprehensive experimental design should include:

  • Model generation and validation:

    • Create precise genetic models using CRISPR/Cas9 targeting of syndig1l, similar to approaches used for syngap1a/b

    • Validate models at RNA and protein levels to confirm loss-of-function

    • Map syndig1l splice variants to identify potential isoform-specific functions

  • Developmental analyses:

    • Assess neurogenesis, neuronal migration, and circuit formation

    • Examine synapse density, morphology, and maturation through development

    • Evaluate compensatory mechanisms through developmental transcriptomics

  • Functional characterization:

    • Perform electrophysiological recordings to assess synaptic transmission

    • Conduct calcium imaging to evaluate circuit activity

    • Implement behavioral phenotyping including context-dependent assays (acoustic, visual-motor, habituation)

  • Pharmacological interventions:

    • Test responsiveness to compounds targeting relevant synaptic pathways

    • Assess rescue of phenotypes through targeted manipulations

  • Comparative analysis:

    • Compare phenotypes with established models of neurodevelopmental disorders

    • Evaluate interactions with other risk genes through compound mutant analysis

This comprehensive approach would provide insights into syndig1l's potential contribution to neurodevelopmental conditions while establishing its place in the broader landscape of synaptic proteins implicated in these disorders.

What are the common technical challenges when working with recombinant syndig1l and how can they be addressed?

Researchers working with recombinant syndig1l may encounter several technical challenges:

ChallengePossible CausesSolutions
Low protein solubilityHydrophobic transmembrane domainsUse appropriate detergents (e.g., DDM, CHAPS); express soluble domains separately; optimize buffer conditions with glycerol
Protein aggregationImproper folding; concentration too highLower protein concentration; add stabilizing agents; optimize reconstitution protocol
Degradation during storageProteolytic activity; freeze-thaw cyclesAdd protease inhibitors; aliquot for single use; store at -80°C; add recommended 50% glycerol
Loss of activityImproper handling; denaturationAvoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week
Non-specific interactions in binding assaysExposed hydrophobic regions; tag interferenceOptimize blocking agents; include detergents in binding buffers; consider tag-removal strategies
Batch-to-batch variabilityExpression system differences; purification variationsSource from reliable suppliers guaranteeing >85% purity ; perform quality control for each batch

Implementing these solutions systematically can significantly improve experimental outcomes and reproducibility when working with this challenging transmembrane protein.

How can researchers optimize immunodetection methods for zebrafish syndig1l in tissue samples?

Optimizing immunodetection of zebrafish syndig1l in tissue samples requires careful consideration of several parameters:

  • Fixation protocol optimization:

    • Compare paraformaldehyde (2-4%) with alternative fixatives

    • Evaluate fixation duration effects on epitope accessibility

    • Consider antigen retrieval methods (heat-induced, enzymatic)

  • Antibody selection and validation:

    • Test antibodies against recombinant syndig1l standards

    • Validate specificity using syndig1l knockout controls

    • Consider using anti-tag antibodies with tagged recombinant versions for higher specificity

  • Signal amplification strategies:

    • Implement tyramide signal amplification for low abundance detection

    • Explore fluorescent secondary antibody combinations for co-localization studies

    • Consider proximity ligation assays for protein interaction studies

  • Background reduction techniques:

    • Optimize blocking solutions (BSA, serum, commercial blockers)

    • Include tissue-specific autofluorescence quenching steps

    • Implement stringent washing procedures

  • Technical comparison table:

Detection MethodSensitivitySpecificityQuantification PotentialBest Application
Chromogenic IHCModerateGoodLimitedGeneral localization
Fluorescent IHCHighVery goodGoodCo-localization studies
Western blottingModerateVery goodGoodExpression level analysis
In situ hybridizationN/A (RNA)HighModerateExpression pattern analysis

These methodological considerations should be systematically tested and optimized for the specific research question and tissue type under investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.