Recombinant Danio rerio Tail-anchored protein insertion receptor WRB (wrb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; wrb; Guided entry of tail-anchored proteins factor 1; Tail-anchored protein insertion receptor WRB; Tryptophan-rich basic protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
wrb
Target Protein Sequence
MAAGFNWFLVLSSVFLCNLVKTFLPSISSFLSKIFHKDADQEMEMRTEIQNMKMELSTIS MMDEFARYARLERKINKMTDQLKTLVKSRTAQQAKMKWIVNIAFYILQAALMISLILKYY ADPVTVVPSKWIAPLERLVAFPSGVAGGVGITCWLVVCNKVVALILQAVS
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). It functions as a membrane receptor, in conjunction with CAMLG/GET2, for soluble GET3/TRC40. This complex recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol, ensuring the correct topology and ER insertion of CAMLG.
Gene References Into Functions
  1. WRB may exhibit tissue-specific functions in the visual system and heart, or maintain dual roles within the same tissue. The selective defects observed at sensory neuron ribbon synapses suggest unique biosynthetic requirements for cells possessing ribbon synapses. This may also indicate a novel role for WRB, acting via the GET pathway, in synaptic function. PMID: 27273592
  2. WRB plays a crucial role in synaptic functions within inner-ear hair cells and retinal photoreceptors. PMID: 26593130
Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is WRB and what is its primary function in Danio rerio?

WRB (Tryptophan-rich basic protein) functions as the endoplasmic reticulum (ER) membrane receptor for TRC40/Asna1-mediated insertion of tail-anchored (TA) proteins. It is an ER-resident membrane protein that shows significant sequence similarity to Get1, a subunit of the membrane receptor complex for yeast Get3. WRB specifically interacts with TRC40/Asna1 and recruits it to the ER membrane, playing a crucial role in the post-translational targeting and membrane insertion pathway for TA proteins .

The protein contains three predicted transmembrane domains (TMDs) and a cytosolically exposed coiled-coil domain between the first and second TMDs. This coiled-coil domain exhibits the highest degree of conservation between orthologs and serves as the primary binding site for TRC40/Asna1 .

What are the optimal storage conditions for recombinant Danio rerio WRB protein?

Recombinant Danio rerio WRB should be stored according to its formulation. For liquid formulations, the shelf life is approximately 6 months at -20°C/-80°C, while lyophilized formulations can maintain stability for about 12 months at -20°C/-80°C. Research indicates that repeated freeze-thaw cycles significantly reduce protein activity, so working aliquots should be stored at 4°C and used within one week .

For reconstitution of lyophilized protein, researchers should:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard for long-term storage)

  • Prepare small aliquots to minimize freeze-thaw cycles

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage

How can I verify the functionality of recombinant WRB protein in vitro?

To assess the functional activity of recombinant WRB protein, researchers should implement a multi-step verification protocol:

  • Binding assay with TRC40/Asna1: Conduct co-immunoprecipitation experiments using the recombinant WRB and TRC40/Asna1 to confirm direct interaction. This can be performed using standard pull-down assays with tagged proteins.

  • Recruitment assay: Utilize fluorescently labeled TRC40/Asna1 and microsomes or reconstituted liposomes containing recombinant WRB to demonstrate recruitment to membranes.

  • Functional insertion assay: Test the ability of recombinant WRB to facilitate insertion of model TA proteins (such as cytochrome b5 or Sec61β) into liposomes or semi-permeabilized cells in the presence of TRC40/Asna1.

  • Competitive inhibition: Use the soluble coiled-coil domain of WRB as a control to competitively inhibit the activity of full-length WRB, as research has shown this domain alone can interfere with TRC40/Asna1-mediated membrane insertion of TA proteins .

For quantitative assessment, researchers should measure insertion efficiency through protease protection assays or by tracking the glycosylation state of engineered TA protein substrates.

What methods are recommended for studying WRB expression patterns in zebrafish development?

For developmental studies of WRB expression in zebrafish, researchers should employ:

  • Whole-mount in situ hybridization (WISH): To visualize spatial and temporal expression patterns of WRB mRNA throughout embryonic development.

  • Quantitative RT-PCR: For precise measurement of WRB transcript levels at different developmental stages.

  • Immunohistochemistry (IHC): Using specific antibodies against WRB to detect protein localization in tissue sections, particularly in the heart, eyes, and other organs where WRB may play developmental roles .

  • Transgenic reporter lines: Generate zebrafish lines expressing fluorescent proteins under the control of the WRB promoter to track expression in real-time during development.

  • Tissue-specific immunoblotting: For quantitative analysis of WRB protein levels in dissected tissues at various developmental timepoints.

The transparency of zebrafish embryos makes them particularly advantageous for imaging studies, allowing for real-time observation of reporter gene expression patterns without extensive tissue processing .

What approaches can be used to investigate the structure-function relationship of WRB's coiled-coil domain?

Investigating the structure-function relationship of WRB's coiled-coil domain requires sophisticated methodological approaches:

  • Site-directed mutagenesis: Systematically mutate conserved residues within the coiled-coil domain to identify critical amino acids for TRC40/Asna1 binding. Key residues can be identified by sequence alignment with Get1 and other WRB orthologs.

  • Truncation and chimeric protein analysis: Generate truncated versions of the coiled-coil domain and chimeric proteins with coiled-coil domains from related proteins to map minimal binding regions.

  • Structural biology approaches:

    • X-ray crystallography of the isolated coiled-coil domain or co-crystallization with TRC40/Asna1

    • NMR spectroscopy for solution structure determination

    • Cryo-electron microscopy for visualization of the WRB-TRC40 complex

  • Biophysical interaction studies:

    • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters

    • Fluorescence resonance energy transfer (FRET) for real-time monitoring of protein interactions

    • Surface plasmon resonance (SPR) to measure association and dissociation kinetics

  • Computational modeling: Molecular dynamics simulations to predict structural changes upon binding and identify potential allosteric effects.

Research has already shown that the coiled-coil domain alone can interfere with TRC40/Asna1-mediated membrane insertion, suggesting it serves as a critical docking site for TRC40 .

How does WRB function compare across different Danio species, and what evolutionary insights can be derived?

Comparative analysis of WRB across Danio species offers valuable evolutionary insights:

  • Sequence conservation analysis: Perform phylogenetic analysis of WRB sequences from multiple Danio species (including D. rerio, D. albolineatus, D. aesculapii, D. quagga, D. kyathit, D. nigrofasciatus, D. tinwini, D. kerri, D. choprae, D. margaritatus, and D. eythromicron) to identify highly conserved regions that likely correspond to essential functional domains.

  • Expression pattern comparison: Compare WRB expression patterns across species using in situ hybridization and immunohistochemistry to identify conserved and divergent expression domains.

  • Functional complementation studies: Test whether WRB proteins from different Danio species can functionally complement each other in knockout or knockdown models.

  • Correlation with physiological differences: Investigate whether differences in WRB sequence or expression correlate with species-specific physiological traits, particularly in cardiac and ocular development where WRB has been implicated in disease.

  • Selective pressure analysis: Calculate Ka/Ks ratios to determine whether WRB has been under purifying, neutral, or positive selection during Danio evolution.

This comparative approach may reveal how WRB function has been conserved or adapted across the 14 of 17 assessed Danio species that share common ancestry .

What are the most effective approaches for WRB gene knockdown or knockout in zebrafish models?

For genetic manipulation of WRB in zebrafish, researchers can employ several cutting-edge approaches:

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting exons of the WRB gene

    • Inject CRISPR/Cas9 components into one-cell stage embryos

    • Screen F0 embryos for mutations using T7 endonuclease assay or direct sequencing

    • Raise F0 fish to adulthood and screen for germline transmission

    • Establish homozygous lines through selective breeding

  • Morpholino oligonucleotides:

    • Design translation-blocking or splice-blocking morpholinos

    • Inject into one-cell stage embryos at carefully titrated doses

    • Include appropriate controls (standard control morpholino and rescue experiments)

    • Note that morpholinos provide transient knockdown, ideal for early developmental studies

  • Dominant negative approaches:

    • Express the isolated coiled-coil domain of WRB, which has been shown to interfere with TRC40/Asna1-mediated membrane insertion of TA proteins

    • Use heat-shock or tissue-specific promoters for conditional expression

  • Conditional knockout strategies:

    • Implement Cre/loxP or similar systems for tissue-specific or temporally controlled gene inactivation

    • This approach is particularly valuable for studying WRB's role in specific tissues while avoiding early developmental lethality

Each approach has distinct advantages and limitations that should be considered based on the specific research question being addressed.

What phenotypic analyses should be conducted in WRB-deficient zebrafish models?

When characterizing WRB-deficient zebrafish models, researchers should conduct comprehensive phenotypic analyses:

  • Developmental timing assessment:

    • Monitor key developmental milestones

    • Track growth parameters (body length, head size)

    • Document any developmental delays or defects

  • Cardiovascular analyses:

    • Heart morphology assessment using transgenic cardiac markers

    • Heart rate measurements at different developmental stages

    • Blood flow visualization using microangiography

    • Cardiac function evaluation via high-speed video microscopy

  • Ocular development assessment:

    • Retinal organization and photoreceptor development

    • Vision tests using optokinetic response (OKR) assays

    • Lens and corneal morphology examination

  • ER stress and unfolded protein response evaluation:

    • RT-qPCR for ER stress markers

    • Immunostaining for ER structure

    • Electron microscopy for ultrastructural changes in the ER

  • Molecular characterization of TA protein insertion:

    • Analyze subcellular localization of model TA proteins

    • Assess membrane integration using biochemical fractionation

    • Quantify cytosolic accumulation of TA proteins

  • Survival and behavioral analyses:

    • Track mortality rates at different developmental stages

    • Assess swimming behavior and responsiveness to stimuli

    • Evaluate stress responses and adaptation

These analyses should be conducted at multiple developmental timepoints to distinguish between primary and secondary effects of WRB deficiency.

How can I identify novel interaction partners of WRB in zebrafish models?

To identify novel WRB interaction partners in zebrafish, implement this systematic approach:

  • Proximity-based labeling methods:

    • Express BioID or APEX2-tagged WRB in zebrafish embryos or cells

    • After biotin labeling and purification, identify proximal proteins using mass spectrometry

    • Validate candidates with co-immunoprecipitation and co-localization studies

  • Yeast two-hybrid screening:

    • Use the coiled-coil domain or cytosolic regions of WRB as bait

    • Screen against a zebrafish cDNA library

    • Validate positive interactions through secondary assays

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged WRB in zebrafish embryos or cells

    • Perform immunoprecipitation under various conditions (including crosslinking)

    • Identify co-precipitating proteins by mass spectrometry

  • Split-protein complementation assays:

    • Fuse WRB to one half of a reporter protein (e.g., luciferase, GFP)

    • Create a library of candidate partners fused to the complementary half

    • Screen for reconstituted activity indicating protein-protein interaction

  • Genetic interaction screens:

    • Perform synthetic lethality screens using CRISPR/Cas9 libraries

    • Identify genes that show enhanced or suppressed phenotypes when mutated in combination with WRB

Given that WRB shows functional similarity to yeast Get1, researchers should prioritize testing potential homologs of known yeast Get pathway components in zebrafish .

What methods are optimal for studying the dynamics of TA protein insertion in zebrafish models?

For studying TA protein insertion dynamics in zebrafish models, researchers should consider these methodological approaches:

  • Real-time imaging of fluorescently labeled TA proteins:

    • Generate transgenic lines expressing fluorescent TA protein reporters

    • Use photoactivatable or photoconvertible fluorescent proteins to track newly synthesized proteins

    • Employ high-resolution confocal or light-sheet microscopy for live imaging

  • Pulse-chase analysis:

    • Develop inducible expression systems for TA proteins

    • Track insertion kinetics following induction

    • Use protein synthesis inhibitors to distinguish insertion defects from synthesis defects

  • In vivo proximity ligation assay (PLA):

    • Detect interactions between WRB and TRC40/Asna1 or TA proteins

    • Visualize interaction sites within intact zebrafish tissues

  • Subcellular fractionation coupled with immunoblotting:

    • Separate cytosolic and membrane fractions

    • Quantify distribution of TA proteins between fractions

    • Compare wild-type and WRB-deficient models

  • Tissue-specific perturbation of the WRB-TRC40 pathway:

    • Express dominant-negative constructs in specific tissues

    • Analyze local effects on TA protein targeting

    • Compare tissue-specific requirements for the pathway

These methods should be applied in both wild-type and WRB-deficient contexts to directly assess the contribution of WRB to TA protein insertion in various tissues and developmental stages.

What are common challenges when working with recombinant WRB protein and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant WRB protein:

  • Protein solubility issues:

    • Challenge: As a membrane protein with three transmembrane domains, WRB can exhibit poor solubility.

    • Solution: Use appropriate detergents (DDM, LMNG, or Triton X-100) for extraction; consider working with truncated constructs like the soluble coiled-coil domain for interaction studies .

  • Protein stability concerns:

    • Challenge: Recombinant WRB protein may show reduced stability during purification and storage.

    • Solution: Add glycerol (5-50%) to storage buffers; maintain strict temperature control; avoid repeated freeze-thaw cycles by preparing smaller aliquots .

  • Expression system limitations:

    • Challenge: ER membrane proteins often express poorly in standard systems.

    • Solution: Consider using specialized expression systems like Pichia pastoris or insect cells for full-length protein; yeast expression has been successfully used for recombinant WRB production as indicated in the product specifications .

  • Functional validation difficulties:

    • Challenge: Confirming activity of recombinant WRB in reconstituted systems.

    • Solution: Develop robust in vitro assays using fluorescently labeled TRC40 and model TA proteins; include positive controls.

  • Antibody specificity issues:

    • Challenge: Non-specific binding of antibodies in immunological applications.

    • Solution: Validate antibodies thoroughly; use WRB-deficient samples as negative controls; consider epitope-tagged versions for detection.

  • Reconstitution into membranes:

    • Challenge: Efficiently incorporating WRB into artificial membranes for functional studies.

    • Solution: Optimize lipid composition to mimic ER membranes; carefully control protein-to-lipid ratios; consider nanodiscs for stable membrane protein reconstitution.

What quality control parameters should be assessed for recombinant WRB protein preparations?

Comprehensive quality control of recombinant WRB preparations should include:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target >85% purity)

    • Analytical size exclusion chromatography

    • Mass spectrometry to confirm protein identity and detect contaminants

  • Structural integrity evaluation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Limited proteolysis to verify proper folding

  • Functional activity testing:

    • Binding assays with purified TRC40/Asna1

    • Liposome association experiments

    • TA protein insertion assays in reconstituted systems

  • Stability analysis:

    • Thermal shift assays to determine melting temperature

    • Aggregation propensity assessment using dynamic light scattering

    • Long-term stability monitoring at different storage conditions

  • Detergent content measurement:

    • For membrane protein preparations, quantify residual detergent

    • Ensure detergent concentration is below interference thresholds for downstream applications

  • Endotoxin testing:

    • Particularly important for cell-based and in vivo applications

    • Use LAL (Limulus amebocyte lysate) assay to quantify endotoxin levels

Researchers should establish acceptance criteria for each parameter based on intended applications and maintain detailed quality control records for reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.